Active Recombinant Mouse Dhfr Protein, His-tagged

Cat.No. : Dhfr-7193M
Product Overview : Recombinant mouse DHFR protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-187
Description : Key enzyme in folate metabolism. Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis. Binds its own mRNA and that of DHFRL1.
Form : Liquid
Bio-activity : > 0.2 units/mg, in which one unit will convert 1.0 μmole of 7,8-dihydrofloate and beta-NADPH to 5,6,7,8-tetrahydrofloate and beta-NADP per min at pH 6.5 at 25 centigrade.
Activity Assay:
1. Prepare a 1.55 mL assay buffer. The final concentrations are 50 mM potassium phosphate, 0.072 mM dihydrofolic acid, 0.1 mM beta-nicotinamide dinucleotide phosphate and 0.003 % (w/v) bovine serum albumin.
2. Add 50 μL of recombinant DHFR protein in various concentrations (2 μg, 5 μg) in assay buffer.
3. Mix by inversion and record the decrease at A340 nm for 5 minutes.
Molecular Mass : 23.8 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSSVYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKFEVYEKKD
Purity : > 95 %
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer.
Avoid repeated freezing and thawing.
Concentration : 1.0 mg/mL (determined by Bradford assay)
Storage Buffer : 20 mM Tris-HCl buffer (pH 8.0) containing 10 % glycerol, 2 mM DTT, 0.1 M NaCl
Gene Name Dhfr dihydrofolate reductase [ Mus musculus (house mouse) ]
Official Symbol Dhfr
Synonyms Dhfr; dihydrofolate reductase; AA607882; AI662710; AW555094; 8430436I03Rik; dihydrofolate reductase; EC 1.5.1.3
Gene ID 13361
mRNA Refseq NM_010049
Protein Refseq NP_034179
UniProt ID P00375

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Dhfr Products

Required fields are marked with *

My Review for All Dhfr Products

Required fields are marked with *

0
cart-icon