Recombinant Human DHFR Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DHFR-6261H |
Product Overview : | DHFR MS Standard C13 and N15-labeled recombinant protein (NP_000782) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Dihydrofolate reductase converts dihydrofolate into tetrahydrofolate, a methyl group shuttle required for the de novo synthesis of purines, thymidylic acid, and certain amino acids. While the functional dihydrofolate reductase gene has been mapped to chromosome 5, multiple intronless processed pseudogenes or dihydrofolate reductase-like genes have been identified on separate chromosomes. Dihydrofolate reductase deficiency has been linked to megaloblastic anemia. Several transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 21.5 kDa |
AA Sequence : | MVGSLNCIVAVSQNMGIGKNGDLPWPPLRNEFRYFQRMTTTSSVEGKQNLVIMGKKTWFSIPEKNRPLKGRINLVLSRELKEPPQGAHFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKNDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DHFR dihydrofolate reductase [ Homo sapiens (human) ] |
Official Symbol | DHFR |
Synonyms | DHFR; dihydrofolate reductase; DYR; DHFRP1; |
Gene ID | 1719 |
mRNA Refseq | NM_000791 |
Protein Refseq | NP_000782 |
MIM | 126060 |
UniProt ID | P00374 |
◆ Recombinant Proteins | ||
DHFR-1960H | Recombinant Human DHFR Protein (Met1-Asp187), N-His tagged | +Inquiry |
Dhfr-2545M | Recombinant Mouse Dhfr Protein, Myc/DDK-tagged | +Inquiry |
DHFR-1721C | Recombinant Chicken DHFR | +Inquiry |
DHFR-4556M | Recombinant Mouse DHFR Protein | +Inquiry |
DHFR-2586H | Recombinant Human DHFR Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHFR-353HCL | Recombinant Human DHFR cell lysate | +Inquiry |
DHFR-6946HCL | Recombinant Human DHFR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHFR Products
Required fields are marked with *
My Review for All DHFR Products
Required fields are marked with *
0
Inquiry Basket