Active Recombinant Mouse Fgf21 Protein (182 aa)
Cat.No. : | Fgf21-414F |
Product Overview : | Recombinant Mouse Fibroblast Growth Factor-21(FGF-21) produced in E. coli is a single non-glycosylated polypeptide chain containing 182 amino acids. A fully biologically active molecule, rmFGF-21 has a molecular mass of 19.9 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 182 |
Description : | Fibroblast growth factor-21 (FGF21) belongs to the large FGF family which has at least 23 members. Along with FGF-19/15 and FGF-23, FGF-21 is categorized as a member of the atypical FGF subfamily, as it must be complexed to the Klotho co-receptor in order to bind to the FGF receptors and activate the downstream signaling pathway. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.5 μg/mL,measured by a cell proliferation assay using NIH-3T3 cells in the presence of 1.25 μg/mL mouse Klotho and 10 μg/mL heparin, corresponding to a specific activity of > 2 × 10^3 units/mg. |
Molecular Mass : | 19.9 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 97% as analyzed by SDS-PAGE& HPLC. |
Storage : | Lyophilized recombinant Mouse Fibroblast Growth Factor-21(FGF-21), remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Mouse FGF-21 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Fgf21 fibroblast growth factor 21 [ Mus musculus ] |
Official Symbol | Fgf21 |
Synonyms | FGF21; fibroblast growth factor 21; FGF-21; |
Gene ID | 56636 |
mRNA Refseq | NM_020013 |
Protein Refseq | NP_064397 |
UniProt ID | Q9JJN1 |
◆ Recombinant Proteins | ||
FGF21-120F | Active Recombinant Human FGF21 Protein (182 aa) | +Inquiry |
Fgf21-193M | Recombinant Mouse Fgf21 protein, His/S-tagged | +Inquiry |
FGF21-4111H | Recombinant Human FGF21 Protein, GST-tagged | +Inquiry |
FGF21-117H | Active Recombinant Human FGF21 Protein (His29-Ser209), C-His tagged, Animal-free, Carrier-free | +Inquiry |
FGF21-192H | Recombinant Human FGF21 protein, His/S-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF21-1890MCL | Recombinant Mouse FGF21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fgf21 Products
Required fields are marked with *
My Review for All Fgf21 Products
Required fields are marked with *
0
Inquiry Basket