Species : |
Mouse |
Source : |
E.coli |
Protein Length : |
182 |
Description : |
Fibroblast growth factor-21 (FGF21) belongs to the large FGF family which has at least 23 members. Along with FGF-19/15 and FGF-23, FGF-21 is categorized as a member of the atypical FGF subfamily, as it must be complexed to the Klotho co-receptor in order to bind to the FGF receptors and activate the downstream signaling pathway. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
ED50 < 0.5 μg/mL,measured by a cell proliferation assay using NIH-3T3 cells in the presence of 1.25 μg/mL mouse Klotho and 10 μg/mL heparin, corresponding to a specific activity of > 2 × 10^3 units/mg. |
Molecular Mass : |
19.9 kDa, observed by reducing SDS-PAGE. |
AA Sequence : |
AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS |
Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
Purity : |
> 97% as analyzed by SDS-PAGE& HPLC. |
Storage : |
Lyophilized recombinant Mouse Fibroblast Growth Factor-21(FGF-21), remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Mouse FGF-21 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
Reconstitution : |
Reconstituted in ddH2O or PBS at 100 μg/mL. |