Active Recombinant Mouse Ifng Protein
Cat.No. : | Ifng-078M |
Product Overview : | Purified recombinant protein of Mouse interferon gamma (Ifng) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mice deficient in this gene have increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. |
Bio-activity : | Determined by its ability to inhibit the proliferation of murine WEHI-279 cells. The expected ED50 is less than or equal to 0.2 ng/ml, corresponding to a specific activity of > 5 x 10^6 units/mg. |
Molecular Mass : | 15.6 kDa |
AA Sequence : | MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Ifng interferon gamma [ Mus musculus (house mouse) ] |
Official Symbol | Ifng |
Synonyms | Ifng; interferon gamma; Ifg; IFN-g; interferon gamma; IFN-gamma; gamma interferon |
Gene ID | 15978 |
mRNA Refseq | NM_008337 |
Protein Refseq | NP_032363 |
UniProt ID | P01580 |
◆ Recombinant Proteins | ||
IFNG-2508H | Recombinant Human IFNG Protein (Gln24-Gly161), N-His tagged | +Inquiry |
IFNg-19E | Recombinant Equine IFN gamma | +Inquiry |
Ifng-549R | Recombinant Rat Ifng protein, His-tagged | +Inquiry |
IFNG-145H | Recombinant Human Interferon, Gamma, His-tagged | +Inquiry |
IFNG-8157B | Recombinant Bovine IFNG protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ifng Products
Required fields are marked with *
My Review for All Ifng Products
Required fields are marked with *
0
Inquiry Basket