Active Recombinant Mouse Il21 Protein

Cat.No. : Il21-153M
Product Overview : Purified recombinant protein of Mouse interleukin 21 (Il21) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG1 and IgG3 in B-cells. May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation.
Bio-activity : Measured by its ability to increase proliferation in mouse splenocytes induced by anti-hCD40 mAb. The expected ED50 is 15-20 ng/ml.
Molecular Mass : 15 kDa
AA Sequence : MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Il21 interleukin 21 [ Mus musculus (house mouse) ]
Official Symbol Il21
Synonyms Il21; interleukin 21; IL-21; interleukin-21
Gene ID 60505
mRNA Refseq NM_021782
Protein Refseq NP_068554
UniProt ID Q9ES17

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il21 Products

Required fields are marked with *

My Review for All Il21 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon