Recombinant Human interleukin 21 Protein, Tag Free, Animal Free
| Cat.No. : | IL21-05H |
| Product Overview : | Recombinant human IL-21 (30-162aa) without tag was expressed in E. coli and purified by using conventional chromatography techniques. Produced using non-animal reagents in an animal-free laboratory. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 30-162aa |
| Description : | This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
| Tag : | Non |
| Form : | Liquid |
| Bio-activity : | The activity is determined by the IFN-γ ELISA in a using NK-92 human natural killer cells. The ED50 range ≤ 4 ng/mL. |
| Molecular Mass : | 15.5 kDa |
| AA Sequence : | MQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS |
| Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
| Purity : | > 95% by SDS-PAGE |
| Applications : | SDS-PAGE, Bioactivity |
| Notes : | For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
| Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) |
| Concentration : | 0.25 mg/mL (determined by absorbance at 280nm) |
| References : | 1. Gui G., et al. (2017) Clin Immunol. 183:266-272. 2. Parrish-Novak J., et al. (2000) Nature. 408(6808):57-63. |
| Gene Name | IL21 interleukin 21 [ Homo sapiens (human) ] |
| Official Symbol | IL21 |
| Synonyms | IL21; interleukin 21; Za11; IL-21; CVID11; interleukin-21 |
| Gene ID | 59067 |
| mRNA Refseq | NM_021803 |
| Protein Refseq | NP_068575 |
| MIM | 605384 |
| UniProt ID | Q9HBE4 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL21 Products
Required fields are marked with *
My Review for All IL21 Products
Required fields are marked with *
Recently Viewed
