| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
30-162aa |
| Description : |
This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
| Tag : |
Non |
| Form : |
Liquid |
| Bio-activity : |
The activity is determined by the IFN-γ ELISA in a using NK-92 human natural killer cells. The ED50 range ≤ 4 ng/mL. |
| Molecular Mass : |
15.5 kDa |
| AA Sequence : |
MQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS |
| Endotoxin : |
< 1 EU/μg of protein (determined by LAL method) |
| Purity : |
> 95% by SDS-PAGE |
| Applications : |
SDS-PAGE, Bioactivity |
| Notes : |
For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Storage Buffer : |
Phosphate-Buffered Saline (pH 7.4) |
| Concentration : |
0.25 mg/mL (determined by absorbance at 280nm) |
| References : |
1. Gui G., et al. (2017) Clin Immunol. 183:266-272.
2. Parrish-Novak J., et al. (2000) Nature. 408(6808):57-63. |
