Recombinant Human interleukin 21 Protein, Tag Free, Animal Free

Cat.No. : IL21-05H
Product Overview : Recombinant human IL-21 (30-162aa) without tag was expressed in E. coli and purified by using conventional chromatography techniques. Produced using non-animal reagents in an animal-free laboratory.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 30-162aa
Description : This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Tag : Non
Form : Liquid
Bio-activity : The activity is determined by the IFN-γ ELISA in a using NK-92 human natural killer cells. The ED50 range ≤ 4 ng/mL.
Molecular Mass : 15.5 kDa
AA Sequence : MQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Storage Buffer : Phosphate-Buffered Saline (pH 7.4)
Concentration : 0.25 mg/mL (determined by absorbance at 280nm)
References : 1. Gui G., et al. (2017) Clin Immunol. 183:266-272.
2. Parrish-Novak J., et al. (2000) Nature. 408(6808):57-63.
Gene Name IL21 interleukin 21 [ Homo sapiens (human) ]
Official Symbol IL21
Synonyms IL21; interleukin 21; Za11; IL-21; CVID11; interleukin-21
Gene ID 59067
mRNA Refseq NM_021803
Protein Refseq NP_068575
MIM 605384
UniProt ID Q9HBE4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL21 Products

Required fields are marked with *

My Review for All IL21 Products

Required fields are marked with *

0
cart-icon
0
compare icon