Active Recombinant Mouse Il3 Protein
Cat.No. : | Il3-107M |
Product Overview : | Purified recombinant protein of Mouse interleukin 3 (Il3) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes. |
Bio-activity : | The ED50 as determined by the dose-dependent stimulation of the proliferation of murine NFS-60 cells is less than or equal to 0.05 ng/ml, corresponding to a specific activity of > 2 x 10^7 units/mg. |
Molecular Mass : | 15.1 kDa |
AA Sequence : | MDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Il3 interleukin 3 [ Mus musculus (house mouse) ] |
Official Symbol | Il3 |
Synonyms | Il3; interleukin 3; BPA; PSF; HCGF; Il-3; MCGF; Csfmu; interleukin-3; P-cell-stimulating factor; hematopoietic growth factor; mast cell growth factor; multipotential colony-stimulating factor |
Gene ID | 16187 |
mRNA Refseq | NM_010556 |
Protein Refseq | NP_034686 |
UniProt ID | P01586 |
◆ Recombinant Proteins | ||
IL3-4276H | Recombinant Human IL3 Protein (Met1-Phe152), C-His tagged | +Inquiry |
IL3-246I | Active Recombinant Human IL3 Protein | +Inquiry |
ll3-542M | Recombinant Mouse Iterleukin 3 | +Inquiry |
IL3-132H | Recombinant Human Interleukin 3 (colony-stimulating factor, multiple), His-tagged | +Inquiry |
IL3-1734C | Recombinant Chicken IL3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL3-445RCL | Recombinant Rat IL3 cell lysate | +Inquiry |
IL3-607HCL | Recombinant Human IL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il3 Products
Required fields are marked with *
My Review for All Il3 Products
Required fields are marked with *
0
Inquiry Basket