Recombinant Canine IL3 protein
| Cat.No. : | IL3-407D |
| Product Overview : | Recombinant Canine IL3 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Canine |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 120 |
| Description : | Interleukin-3 (IL-3) is a type of biological signal (cytokine) which is encoded by the IL-3 gene located on chromosome 5 and produced primarily by activated T cells beside human thymic epithelial cells, activated murine mast cells, murine keratinocytes and neurons/astrocytes. The protein acts in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. The canine IL-3 reported to be a monomer, as it is known, contains 120 amino acids residues which is a single non-glycosylated polypeptide. The canine IL-3 shares < 40 % amino acid sequence identity with IL-3 of other mammals. |
| Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁶ IU/mg. |
| Molecular Mass : | Approximately 14.0 kDa, a single non-glycosylated polypeptide chain containing 120 amino acids. |
| AA Sequence : | RPFSTDLPKQYFTMINEIMEMLNKSPSPSEEPLDSNEKETLLEDTLLRPNLDVFLNASSKFHKNGLLIWNNLKEFLPLLPTPTPRGEPISIMENNWGDFQRKLKKYLEALDNFLNFKNKP |
| Endotoxin : | Less than 1 EU/μg of rCaIL-3 as determined by LAL method. |
| Purity : | >97% by SDS-PAGE and HPLC analysis. |
| Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
| Gene Name | IL3 |
| Official Symbol | IL3 |
| Synonyms | Hematopoietic Growth Factor, MCGF, Multipotential Colony-stimulating Factor, P-cell-stimulating Factor |
| Gene ID | 481497 |
| mRNA Refseq | NM_001013835.1 |
| Protein Refseq | NP_001013857.1 |
| UniProt ID | Q9BDX4 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL3 Products
Required fields are marked with *
My Review for All IL3 Products
Required fields are marked with *



