Recombinant Canine IL3 protein

Name: Recombinant Canine IL3 protein
SKU: IL3-407D

Species :	Canine
Source :	E.coli
Tag :	Non
Protein Length :	120
Description :	Interleukin-3 (IL-3) is a type of biological signal (cytokine) which is encoded by the IL-3 gene located on chromosome 5 and produced primarily by activated T cells beside human thymic epithelial cells, activated murine mast cells, murine keratinocytes and neurons/astrocytes. The protein acts in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. The canine IL-3 reported to be a monomer, as it is known, contains 120 amino acids residues which is a single non-glycosylated polypeptide. The canine IL-3 shares < 40 % amino acid sequence identity with IL-3 of other mammals.
Form :	Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity :	Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁶ IU/mg.
Molecular Mass :	Approximately 14.0 kDa, a single non-glycosylated polypeptide chain containing 120 amino acids.
AA Sequence :	RPFSTDLPKQYFTMINEIMEMLNKSPSPSEEPLDSNEKETLLEDTLLRPNLDVFLNASSKFHKNGLLIWNNLKEFLPLLPTPTPRGEPISIMENNWGDFQRKLKKYLEALDNFLNFKNKP
Endotoxin :	Less than 1 EU/μg of rCaIL-3 as determined by LAL method.
Purity :	>97% by SDS-PAGE and HPLC analysis.
Storage :	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution :	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Name	IL3
Official Symbol	IL3
Synonyms	Hematopoietic Growth Factor, MCGF, Multipotential Colony-stimulating Factor, P-cell-stimulating Factor
Gene ID	481497
mRNA Refseq	NM_001013835.1
Protein Refseq	NP_001013857.1
UniProt ID	Q9BDX4