Recombinant Human IL3 protein(41-130 aa), C-His-tagged

• Cat.No.: IL3-2600H
• Product Overview: Recombinant Human IL3 protein(P08700)(41-130 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 41-130 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 13 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: EIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKL

Gene Information

• Gene Name: IL3 interleukin 3 (colony-stimulating factor, multiple) [ Homo sapiens ]
• Official Symbol: IL3
• Synonyms: IL3; interleukin 3 (colony-stimulating factor, multiple); interleukin-3; hematopoietic growth factor; IL 3; mast cell growth factor; MCGF; MGC79398; MGC79399; MULTI CSF; multilineage colony stimulating factor; P cell stimulating factor; mast-cell growth factor; P-cell stimulating factor; P-cell-stimulating factor; multilineage-colony-stimulating factor; multipotential colony-stimulating factor; IL-3; MULTI-CSF
• Gene ID: 3562
• mRNA Refseq: NM_000588
• Protein Refseq: NP_000579
• MIM: 147740
• UniProt ID: P08700