Active Recombinant Mouse Il5 Protein (113 aa)

Cat.No. : Il5-353I
Product Overview : Recombinant mouse Interleukin-5 (rmIL-5) produced in E. coli is a disulfide-linked homodimer containing two non-glycosylated polypeptide chains of 113 amino acids each. A fully biologically active molecule, rmIL-5 has a molecular mass of 26.2kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 113
Description : Interleukin-5 (IL-5),produced by mast cells, T cells and eosinophils, is responsible for the activities attributed to eosinophil differentiating factor, B cell growth factor II and T cell-replacing factor (TRF). It can increase production and mobilization of eosinophils and CD34+ progenitors from the bone marrow. IL-5 plays an important role in inducing cell-mediated immunity against parasitic infections and certain tumors. IL-5 also promotes differentiation of basophils and primes them for histamine and leukotriene release.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 2.0 ng/mL, measured by a cell proliferation assay using TF-1 Cells, corresponding to a specific activity of > 5.0 × 10^5 units/mg.
Molecular Mass : 26.2kDa, observed by non-reducing SDS-PAGE.
AA Sequence : MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE and HPLC analyses.
Storage : Lyophilized recombinant mouse Interleukin-5 (rmIL-5) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmIL-5 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name Il5 interleukin 5 [ Mus musculus ]
Official Symbol Il5
Synonyms IL5; interleukin 5; interleukin-5; TRF; BCGF-II; B-cell growth factor II; T-cell replacing factor; cytotoxic T-lymphocyte inducer; eosinophil differentiation factor; Il-5;
Gene ID 16191
mRNA Refseq NM_010558
Protein Refseq NP_034688
UniProt ID P04401

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il5 Products

Required fields are marked with *

My Review for All Il5 Products

Required fields are marked with *

0
cart-icon