Active Recombinant Mouse IL7 Protein
Cat.No. : | IL7-188M |
Product Overview : | Recombinant Mouse IL7 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Interleukin 7 (IL-7) is a hematopoietic cytokine that is an important regulator of B and T cell development. IL-7 is secreted by bone marrow and thymic stromal cells, dendritic cells, intestinal epithelial cells, hepatocytes, and keratinocytes. IL-7 signals through the interleukin 7 receptor (IL-7R) to promote the differentiation of hematopoietic stem cells into T cells, B cells, and natural killer cells. IL-7 is also a regulator of intestinal mucosal lymphocyte proliferation. Human and mouse IL-7 show species cross-reactivity. |
Bio-activity : | 2E8 cell proliferation, ≤1 ng/mL |
Molecular Mass : | Monomer, 15 kDa (130 aa) |
AA Sequence : | MECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM acetic acid |
Reconstitution : | Sterile 10 mM acetic acid at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Il7 interleukin 7 [ Mus musculus (house mouse) ] |
Official Symbol | IL7 |
Synonyms | IL7; interleukin 7; interleukin-7; Il-7; hlb368; A630026I06Rik; MGC129342; |
Gene ID | 16196 |
mRNA Refseq | NM_008371 |
Protein Refseq | NP_032397 |
UniProt ID | P10168 |
◆ Recombinant Proteins | ||
Il7-01M | Active Recombinant Mouse Il7 Protein, His-Tagged | +Inquiry |
IL7-5695HF | Recombinant Full Length Human IL7 Protein, GST-tagged | +Inquiry |
IL7-55H | Recombinant Human IL7 Protein, His-tagged | +Inquiry |
IL7-572H | Recombinant Human IL7 | +Inquiry |
IL7-0190H | Active Recombinant Human IL7 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL7-5223HCL | Recombinant Human IL7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL7 Products
Required fields are marked with *
My Review for All IL7 Products
Required fields are marked with *