Recombinant Full Length Human IL7 Protein, GST-tagged
Cat.No. : | IL7-5695HF |
Product Overview : | Human IL7 full-length ORF ( AAH47698, 26 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
ProteinLength : | 26-177 amino acids |
Description : | The protein encoded by this gene is a cytokine important for B and T cell development. This cytokine and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. This cytokine is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. This cytokine can be produced locally by intestinal epithelial and epithelial goblet cells, and may serve as a regulatory factor for intestinal mucosal lymphocytes. Knockout studies in mice suggested that this cytokine plays an essential role in lymphoid cell survival. [provided by RefSeq |
Molecular Mass : | 42.46 kDa |
AA Sequence : | DCDIEGKDGKQYESVLVVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IL7 interleukin 7 [ Homo sapiens ] |
Official Symbol | IL7 |
Synonyms | IL7; interleukin 7; interleukin-7; IL 7; IL-7; |
Gene ID | 3574 |
mRNA Refseq | NM_000880 |
Protein Refseq | NP_000871 |
MIM | 146660 |
UniProt ID | P13232 |
◆ Recombinant Proteins | ||
Tmem229b-6492M | Recombinant Mouse Tmem229b Protein, Myc/DDK-tagged | +Inquiry |
PDRG1-4359R | Recombinant Rat PDRG1 Protein | +Inquiry |
HA-694V | Recombinant H6N2 (A/duck/Shantou/83/2000) HA Protein, His-tagged | +Inquiry |
MCAM-616H | Recombinant Human MCAM, His tagged | +Inquiry |
SOCS3-2068H | Recombinant Human SOCS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
MMP8-1656H | Active Native Human MMP8 Protein | +Inquiry |
ctxA-145V | Native Cholera Toxin A | +Inquiry |
HB-41D | Native Dog Hemoglobin (HB) Protein | +Inquiry |
Hp1-1-195H | Native Human Haptoglobin 1-1 | +Inquiry |
BGLAP-57H | Native Human Osteocalcin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNAP29-1652HCL | Recombinant Human SNAP29 cell lysate | +Inquiry |
NTM-3668HCL | Recombinant Human NTM 293 Cell Lysate | +Inquiry |
MYCL1-4037HCL | Recombinant Human MYCL1 293 Cell Lysate | +Inquiry |
ZNF274-106HCL | Recombinant Human ZNF274 293 Cell Lysate | +Inquiry |
TBC1D9B-653HCL | Recombinant Human TBC1D9B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL7 Products
Required fields are marked with *
My Review for All IL7 Products
Required fields are marked with *
0
Inquiry Basket