Active Recombinant Mouse Il7 Protein, His-Tagged
Cat.No. : | Il7-01M |
Product Overview : | Recombinant mouse Il7 Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Interleukin 7 (IL-7) is a protein that in humans is encoded by the IL7 gene. IL-7 stimulates the differentiation of multipotent (pluripotent) hematopoietic stem cells into lymphoid progenitor cells. It is important for proliferation during certain stages of B-cell maturation, T and NK cell survival, development and homeostasis. |
Form : | Lyophilized powder |
AA Sequence : | MECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNC TSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC). The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant mouse IL-7 is > 5 x 10^6 IU/mg. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Il7 interleukin 7 [ Mus musculus (house mouse) ] |
Official Symbol | Il7 |
Synonyms | Il-7; hlb368; A630026I06Rik |
Gene ID | 16196 |
mRNA Refseq | NM_001313888.1 |
Protein Refseq | NP_001300817.1 |
UniProt ID | A0A8C6HCD6 |
◆ Recombinant Proteins | ||
Il7-77M | Recombinant Mouse Il7 protein | +Inquiry |
IL7-51H | Active Recombinant Human Interleukin 7, MIgG2a Fc-tagged | +Inquiry |
IL7-032E | Recombinant Human IL7 protein | +Inquiry |
IL7-234I | Active Recombinant Human IL7 Protein, His-tagged | +Inquiry |
IL7-5333H | Recombinant Human Interleukin 7, HQ-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL7-5223HCL | Recombinant Human IL7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il7 Products
Required fields are marked with *
My Review for All Il7 Products
Required fields are marked with *
0
Inquiry Basket