Active Recombinant Mouse Il7 Protein, His-Tagged

Cat.No. : Il7-01M
Product Overview : Recombinant mouse Il7 Protein, His-tagged was expressed in E. coli cell
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Interleukin 7 (IL-7) is a protein that in humans is encoded by the IL7 gene. IL-7 stimulates the differentiation of multipotent (pluripotent) hematopoietic stem cells into lymphoid progenitor cells. It is important for proliferation during certain stages of B-cell maturation, T and NK cell survival, development and homeostasis.
Form : Lyophilized powder
AA Sequence : MECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNC
TSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI with polyhistidine tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Bio-activity : Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC). The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant mouse IL-7 is > 5 x 10^6 IU/mg.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Notes : Please use within one month after protein reconstitution.
Gene Name Il7 interleukin 7 [ Mus musculus (house mouse) ]
Official Symbol Il7
Synonyms Il-7; hlb368; A630026I06Rik
Gene ID 16196
mRNA Refseq NM_001313888.1
Protein Refseq NP_001300817.1
UniProt ID A0A8C6HCD6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il7 Products

Required fields are marked with *

My Review for All Il7 Products

Required fields are marked with *

0
cart-icon
0
compare icon