Active Recombinant Pig IL1B Protein (154 aa)
Cat.No. : | IL1B-364I |
Product Overview : | Recombinant Porcine IL-1β produced in E. coli is a single non-glycosylated polypeptide chain containing 154 amino acids. A fully biologically active molecule, rpIL-1β has a molecular mass of 17.7 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | E.coli |
Protein Length : | 154 |
Description : | Interleukin-1 beta (rpIL-1β) is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. IL-1α and IL-1β are structurally related polypeptides that share approximately 27% amino acid (aa) identity in porcine. While IL-1α and IL-1β are regulated independently, they bind to the same receptor and exert identical biological effects. IL-1β stimulates thymocyte proliferation by inducing il-2 release, b-cell maturation and proliferation, and fibroblast growth factor activity. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 1 ng/mL, measured by the dose-dependent stimulation of mouse D10S cells, corresponding to a specific activity of 1.0 × 10^6 IU/mg. |
Molecular Mass : | 17.7 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Porcine IL-1β, remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Porcine IL-1β should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | IL1B interleukin 1, beta [ Sus scrofa ] |
Official Symbol | IL1B |
Synonyms | IL1B; interleukin 1, beta; interleukin-1 beta; IL-1 beta; prointerleukin-1 beta; |
Gene ID | 397122 |
mRNA Refseq | NM_214055 |
Protein Refseq | NP_999220 |
UniProt ID | P26889 |
◆ Recombinant Proteins | ||
IL1B-2466H | Recombinant Human IL1B Protein (Ala117-Ser268), His tagged | +Inquiry |
IL1B-019D | Active Recombinant Dog IL1B Protein | +Inquiry |
Il1b-1019R | Recombinant Rat Il1b Protein, His-tagged | +Inquiry |
Il1b-7238M | Recombinant Mouse Il1b Protein, His-tagged | +Inquiry |
Il1B-466H | Recombinant Human Il1B, HIgG1 Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL1B Products
Required fields are marked with *
My Review for All IL1B Products
Required fields are marked with *
0
Inquiry Basket