Active Recombinant Dog IL1B Protein

Cat.No. : IL1B-019D
Product Overview : Recombinant canine IL-1beta was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Dog
Source : E.coli
Description : Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production.
Form : Liquid
Bio-activity : Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 range ≤ 5 pg/mL.
Molecular Mass : 17.5 kDa
AA Sequence : MAAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -98 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4)
Gene Name IL1B interleukin 1 beta [ Canis lupus familiaris (dog) ]
Official Symbol IL1B
Synonyms IL1B; interleukin 1 beta; IL-1; interleukin-1 beta; IL-1 beta; interleukin-1 beta proprotein
Gene ID 403974
mRNA Refseq NM_001037971
Protein Refseq NP_001033060.1
UniProt ID Q2VCE2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL1B Products

Required fields are marked with *

My Review for All IL1B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon