Active Recombinant Dog IL1B Protein
Cat.No. : | IL1B-019D |
Product Overview : | Recombinant canine IL-1beta was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Description : | Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. |
Form : | Liquid |
Bio-activity : | Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 range ≤ 5 pg/mL. |
Molecular Mass : | 17.5 kDa |
AA Sequence : | MAAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -98 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) |
Gene Name | IL1B interleukin 1 beta [ Canis lupus familiaris (dog) ] |
Official Symbol | IL1B |
Synonyms | IL1B; interleukin 1 beta; IL-1; interleukin-1 beta; IL-1 beta; interleukin-1 beta proprotein |
Gene ID | 403974 |
mRNA Refseq | NM_001037971 |
Protein Refseq | NP_001033060.1 |
UniProt ID | Q2VCE2 |
◆ Recombinant Proteins | ||
IL1B-2918H | Recombinant Human IL1B protein(117-269aa), His-tagged | +Inquiry |
Il1b-161M | Recombinant Active Mouse IL1B Protein, His-tagged(C-ter) | +Inquiry |
IL1B-29H | Active Recombinant Human IL1B Protein, Animal Free | +Inquiry |
IL1B-321H | Recombinant Human IL1B, His-tagged | +Inquiry |
IL1B-577R | Recombinant Rat IL1B, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1B Products
Required fields are marked with *
My Review for All IL1B Products
Required fields are marked with *