Active Recombinant Dog IL1B Protein
| Cat.No. : | IL1B-019D |
| Product Overview : | Recombinant canine IL-1beta was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog |
| Source : | E.coli |
| Description : | Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. |
| Form : | Liquid |
| Bio-activity : | Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 range ≤ 5 pg/mL. |
| Molecular Mass : | 17.5 kDa |
| AA Sequence : | MAAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS |
| Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
| Purity : | > 95% by SDS-PAGE |
| Applications : | SDS-PAGE, Bioactivity |
| Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -98 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : | 1 mg/mL (determined by absorbance at 280nm) |
| Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) |
| Gene Name | IL1B interleukin 1 beta [ Canis lupus familiaris (dog) ] |
| Official Symbol | IL1B |
| Synonyms | IL1B; interleukin 1 beta; IL-1; interleukin-1 beta; IL-1 beta; interleukin-1 beta proprotein |
| Gene ID | 403974 |
| mRNA Refseq | NM_001037971 |
| Protein Refseq | NP_001033060.1 |
| UniProt ID | Q2VCE2 |
| ◆ Recombinant Proteins | ||
| IL1B-1030F | Active Recombinant Feline IL1B protein(Ala116-Ser267) | +Inquiry |
| Il1B-464H | Active Recombinant Human Il1B, HIgG1 Fc-tagged, mutant | +Inquiry |
| Il1b-1019R | Recombinant Rat Il1b Protein, His-tagged | +Inquiry |
| IL1b-3522G | Active Recombinant Guinea pig IL1b protein, His-tagged | +Inquiry |
| IL1B-02HP | Active Recombinant Human IL1B protein, R-PE labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1B Products
Required fields are marked with *
My Review for All IL1B Products
Required fields are marked with *



