Active Recombinant Dog IL1B Protein

• Cat.No.: IL1B-019D
• Product Overview: Recombinant canine IL-1beta was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Dog
• Source: E.coli
• Description: Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production.
• Form: Liquid
• Bio-activity: Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 range ≤ 5 pg/mL.
• Molecular Mass: 17.5 kDa
• AA Sequence: MAAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -98 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4)

Gene Information

• Gene Name: IL1B interleukin 1 beta [ Canis lupus familiaris (dog) ]
• Official Symbol: IL1B
• Synonyms: IL1B; interleukin 1 beta; IL-1; interleukin-1 beta; IL-1 beta; interleukin-1 beta proprotein
• Gene ID: 403974
• mRNA Refseq: NM_001037971
• Protein Refseq: NP_001033060.1
• UniProt ID: Q2VCE2