Species : |
Rat |
Source : |
E.coli |
Protein Length : |
54 |
Description : |
Epidermal Growth Factor (EGF) is a cytokine with 53 amino acids, originally found in mouse submaxillary gland. EGF binds to EGF receptors, ErbB1 and B4, and causes them to be dimerized and phosphorylated. The dimerized and phosphorylated EGFR can bind to several intracellular targets, such as phospholipase Cγ and Ras-GTPase-acting protein, and achieve a series of cascade reactions. EGF is involved in the regulation of cell proliferation and differentiation, and is up-regulated during wound healing, accelerating reepitheliazation and increasing tensile strength. It also stimulates neurite outgrowth and increases the uptake of dopamine in the central nervous system. On the other hand, EGF is up-regulated in the glioma cancer, and related to the length of survivals of the patients. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
ED50 < 0.08 ng/mL, measured by a cell proliferation assay using 3T3 cells, corresponding to a specific activity of > 1.25 × 10^7 units/mg. |
Molecular Mass : |
6.3 kDa, observed by reducing SDS-PAGE. |
AA Sequence : |
MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR |
Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
Purity : |
> 95% by SDS-PAGE analysis. |
Storage : |
Lyophilized recombinant rat Epidermal Growth Factor (rrEGF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrEGF should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
Reconstitution : |
Reconstituted in ddH2O at 100 μg/mL. |