Active Recombinant Mouse Egf Protein
Cat.No. : | Egf-052M |
Product Overview : | Purified recombinant protein of Mouse epidermal growth factor (Egf) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | This gene encodes epidermal growth factor (EGF), the founding member of the EGF family of growth factors that are implicated in cell proliferation and differentiation. The encoded protein can localize to the membrane and function in juxtacrine signaling or undergo proteolytic processing to generate a soluble form of the hormone. Mice lacking the encoded protein do not exhibit an abnormal phenotype but transgenic mice overexpressing the encoded protein exhibit hypospermatogenesis. |
Bio-activity : | The ED50 was determined by a cell proliferation assay using BALB/c 3T3 cells is less than or equal to 0.1 ng/ml, corresponding to a specific activity of > 1 x 10^7 units/mg. |
Molecular Mass : | 6 kDa |
AA Sequence : | NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Egf epidermal growth factor [ Mus musculus (house mouse) ] |
Official Symbol | Egf |
Synonyms | Egf; epidermal growth factor; AI790464; pro-epidermal growth factor; Pro-epidermal growth factor precursor (EGF) |
Gene ID | 13645 |
mRNA Refseq | NM_010113 |
Protein Refseq | NP_034243 |
UniProt ID | P01132 |
◆ Recombinant Proteins | ||
EGF-6H | Active Recombinant Human Epidermal Growth Factor | +Inquiry |
EGF-2038H | Recombinant Human EGF Protein (Asn971-Arg1023), C-His tagged | +Inquiry |
EGF-262M | Active Recombinant Mouse EGF Protein | +Inquiry |
EGF-316M | Active Recombinant Mouse EGF, MIgG2a Fc-tagged | +Inquiry |
EGF-09H | Active Recombinant Human EGF Protein | +Inquiry |
◆ Native Proteins | ||
Egf -635R | Native Rat Egf protein | +Inquiry |
EGF-26462TH | Native Human EGF | +Inquiry |
Egf-634M | Active Native Mouse Egf | +Inquiry |
Egf -634M | Active Native Mouse Egf protein | +Inquiry |
EGF-23H | Active Native Human EGF protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGF-2716HCL | Recombinant Human EGF cell lysate | +Inquiry |
EGF-973MCL | Recombinant Mouse EGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Egf Products
Required fields are marked with *
My Review for All Egf Products
Required fields are marked with *