Active Recombinant Mouse Egf Protein
| Cat.No. : | Egf-052M |
| Product Overview : | Purified recombinant protein of Mouse epidermal growth factor (Egf) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Description : | This gene encodes epidermal growth factor (EGF), the founding member of the EGF family of growth factors that are implicated in cell proliferation and differentiation. The encoded protein can localize to the membrane and function in juxtacrine signaling or undergo proteolytic processing to generate a soluble form of the hormone. Mice lacking the encoded protein do not exhibit an abnormal phenotype but transgenic mice overexpressing the encoded protein exhibit hypospermatogenesis. |
| Bio-activity : | The ED50 was determined by a cell proliferation assay using BALB/c 3T3 cells is less than or equal to 0.1 ng/ml, corresponding to a specific activity of > 1 x 10^7 units/mg. |
| Molecular Mass : | 6 kDa |
| AA Sequence : | NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR |
| Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. |
| Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
| Gene Name | Egf epidermal growth factor [ Mus musculus (house mouse) ] |
| Official Symbol | Egf |
| Synonyms | Egf; epidermal growth factor; AI790464; pro-epidermal growth factor; Pro-epidermal growth factor precursor (EGF) |
| Gene ID | 13645 |
| mRNA Refseq | NM_010113 |
| Protein Refseq | NP_034243 |
| UniProt ID | P01132 |
| ◆ Recombinant Proteins | ||
| Egf-557M | Active Recombinant Mouse Epidermal Growth Factor | +Inquiry |
| EGF-899P | Recombinant Pig EGF Protein, His-tagged | +Inquiry |
| EGF-037H | Recombinant Human EGF Protein | +Inquiry |
| EGF-2039H | Recombinant Human EGF Protein (Asn971-Arg1023) | +Inquiry |
| EGF-3223M | Active Recombinant Mouse EGF protein, His-GST-tagged | +Inquiry |
| ◆ Native Proteins | ||
| Egf-634M | Active Native Mouse Egf | +Inquiry |
| EGF-26462TH | Native Human EGF | +Inquiry |
| Egf-635R | Native Rat Egf | +Inquiry |
| Egf -635R | Native Rat Egf protein | +Inquiry |
| EGF-23H | Active Native Human EGF protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EGF-973MCL | Recombinant Mouse EGF cell lysate | +Inquiry |
| EGF-2716HCL | Recombinant Human EGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Egf Products
Required fields are marked with *
My Review for All Egf Products
Required fields are marked with *



