Active Recombinant Mouse Egf Protein

Cat.No. : Egf-052M
Product Overview : Purified recombinant protein of Mouse epidermal growth factor (Egf) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : This gene encodes epidermal growth factor (EGF), the founding member of the EGF family of growth factors that are implicated in cell proliferation and differentiation. The encoded protein can localize to the membrane and function in juxtacrine signaling or undergo proteolytic processing to generate a soluble form of the hormone. Mice lacking the encoded protein do not exhibit an abnormal phenotype but transgenic mice overexpressing the encoded protein exhibit hypospermatogenesis.
Bio-activity : The ED50 was determined by a cell proliferation assay using BALB/c 3T3 cells is less than or equal to 0.1 ng/ml, corresponding to a specific activity of > 1 x 10^7 units/mg.
Molecular Mass : 6 kDa
AA Sequence : NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Egf epidermal growth factor [ Mus musculus (house mouse) ]
Official Symbol Egf
Synonyms Egf; epidermal growth factor; AI790464; pro-epidermal growth factor; Pro-epidermal growth factor precursor (EGF)
Gene ID 13645
mRNA Refseq NM_010113
Protein Refseq NP_034243
UniProt ID P01132

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Egf Products

Required fields are marked with *

My Review for All Egf Products

Required fields are marked with *

0
cart-icon