Recombinant Human SAG protein, His-tagged
Cat.No. : | SAG-2501H |
Product Overview : | Recombinant Human SAG protein(1-113 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | August 27, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-113 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SAG S-antigen; retina and pineal gland (arrestin) [ Homo sapiens ] |
Official Symbol | SAG |
Synonyms | SAG; S-antigen; retina and pineal gland (arrestin); S-arrestin; ARRESTIN; arrestin 1; 48 kDa protein; rod photoreceptor arrestin; retinal S-antigen (48 KDa protein); RP47; S-AG; DKFZp686D1084; DKFZp686I1383; |
Gene ID | 6295 |
mRNA Refseq | NM_000541 |
Protein Refseq | NP_000532 |
MIM | 181031 |
UniProt ID | P10523 |
◆ Recombinant Proteins | ||
SAG-1365H | Recombinant Human SAG Protein, His-tagged | +Inquiry |
SAG-301320H | Recombinant Human SAG protein, GST-tagged | +Inquiry |
SAG-1950H | Recombinant Human SAG Protein, His (Fc)-Avi-tagged | +Inquiry |
SAG-283H | Recombinant Human SAG Protein, MYC/DDK-tagged | +Inquiry |
SAG-567HFL | Recombinant Full Length Human SAG Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAG Products
Required fields are marked with *
My Review for All SAG Products
Required fields are marked with *