Recombinant Human SAG Protein, His-tagged
| Cat.No. : | SAG-1365H | 
| Product Overview : | Recombinant Human SAG Protein (1-405aa) was expressed in Yeast with N-terminal His-SUMO tag. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Yeast | 
| Tag : | His | 
| Protein Length : | 1-405 a.a. | 
| Form : | Tris-based buffer, 50% glycerol. | 
| Molecular Mass : | 47.1 kDa | 
| AA Sequence : | MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. | 
| Gene Name | SAG S-antigen; retina and pineal gland (arrestin) [ Homo sapiens ] | 
| Official Symbol | SAG | 
| Synonyms | SAG; S-antigen; retina and pineal gland (arrestin); S-arrestin; ARRESTIN; arrestin 1; 48 kDa protein; rod photoreceptor arrestin; retinal S-antigen (48 KDa protein); RP47; S-AG; DKFZp686D1084; DKFZp686I1383 | 
| Gene ID | 6295 | 
| mRNA Refseq | NM_000541 | 
| Protein Refseq | NP_000532 | 
| MIM | 181031 | 
| UniProt ID | P10523 | 
| ◆ Recombinant Proteins | ||
| Sag-1962M | Recombinant Mouse Sag protein, His & T7-tagged | +Inquiry | 
| SAG-2971H | Recombinant Human SAG protein, GST-tagged | +Inquiry | 
| Sag-3469M | Recombinant Mouse Sag protein, His-tagged | +Inquiry | 
| SAG-2501H | Recombinant Human SAG protein, His-tagged | +Inquiry | 
| Sag-5679M | Recombinant Mouse Sag Protein, Myc/DDK-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAG Products
Required fields are marked with *
My Review for All SAG Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            