Recombinant Human SAG Protein, His-tagged
Cat.No. : | SAG-1365H |
Product Overview : | Recombinant Human SAG Protein (1-405aa) was expressed in Yeast with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-405 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 47.1 kDa |
AA Sequence : | MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | SAG S-antigen; retina and pineal gland (arrestin) [ Homo sapiens ] |
Official Symbol | SAG |
Synonyms | SAG; S-antigen; retina and pineal gland (arrestin); S-arrestin; ARRESTIN; arrestin 1; 48 kDa protein; rod photoreceptor arrestin; retinal S-antigen (48 KDa protein); RP47; S-AG; DKFZp686D1084; DKFZp686I1383 |
Gene ID | 6295 |
mRNA Refseq | NM_000541 |
Protein Refseq | NP_000532 |
MIM | 181031 |
UniProt ID | P10523 |
◆ Recombinant Proteins | ||
SAG-3766H | Recombinant Human SAG protein, His-tagged | +Inquiry |
SAG-2501H | Recombinant Human SAG, His-tagged | +Inquiry |
Sag-1962M | Recombinant Mouse Sag protein, His & T7-tagged | +Inquiry |
SAG-283H | Recombinant Human SAG Protein, MYC/DDK-tagged | +Inquiry |
Sag-5679M | Recombinant Mouse Sag Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAG Products
Required fields are marked with *
My Review for All SAG Products
Required fields are marked with *
0
Inquiry Basket