Recombinant Human SAG Protein, His-tagged

Cat.No. : SAG-1365H
Product Overview : Recombinant Human SAG Protein (1-405aa) was expressed in Yeast with N-terminal His-SUMO tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 1-405 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 47.1 kDa
AA Sequence : MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name SAG S-antigen; retina and pineal gland (arrestin) [ Homo sapiens ]
Official Symbol SAG
Synonyms SAG; S-antigen; retina and pineal gland (arrestin); S-arrestin; ARRESTIN; arrestin 1; 48 kDa protein; rod photoreceptor arrestin; retinal S-antigen (48 KDa protein); RP47; S-AG; DKFZp686D1084; DKFZp686I1383
Gene ID 6295
mRNA Refseq NM_000541
Protein Refseq NP_000532
MIM 181031
UniProt ID P10523

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SAG Products

Required fields are marked with *

My Review for All SAG Products

Required fields are marked with *

0
cart-icon
0
compare icon