Recombinant Human SAG Protein, His-tagged
| Cat.No. : | SAG-1365H |
| Product Overview : | Recombinant Human SAG Protein (1-405aa) was expressed in Yeast with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1-405 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 47.1 kDa |
| AA Sequence : | MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | SAG S-antigen; retina and pineal gland (arrestin) [ Homo sapiens ] |
| Official Symbol | SAG |
| Synonyms | SAG; S-antigen; retina and pineal gland (arrestin); S-arrestin; ARRESTIN; arrestin 1; 48 kDa protein; rod photoreceptor arrestin; retinal S-antigen (48 KDa protein); RP47; S-AG; DKFZp686D1084; DKFZp686I1383 |
| Gene ID | 6295 |
| mRNA Refseq | NM_000541 |
| Protein Refseq | NP_000532 |
| MIM | 181031 |
| UniProt ID | P10523 |
| ◆ Recombinant Proteins | ||
| SAG-301320H | Recombinant Human SAG protein, GST-tagged | +Inquiry |
| SAG-2501H | Recombinant Human SAG protein, His-tagged | +Inquiry |
| SAG-5225R | Recombinant Rat SAG Protein | +Inquiry |
| SAG-14644M | Recombinant Mouse SAG Protein | +Inquiry |
| SAG-4884R | Recombinant Rat SAG Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAG Products
Required fields are marked with *
My Review for All SAG Products
Required fields are marked with *
