Recombinant Human SAG protein, GST-tagged
Cat.No. : | SAG-301320H |
Product Overview : | Recombinant Human SAG (332-405 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Gln332-Glu405 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | QIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SAG S-antigen; retina and pineal gland (arrestin) [ Homo sapiens ] |
Official Symbol | SAG |
Synonyms | SAG; S-antigen; retina and pineal gland (arrestin); S-arrestin; ARRESTIN; arrestin 1; 48 kDa protein; rod photoreceptor arrestin; retinal S-antigen (48 KDa protein); RP47; S-AG; DKFZp686D1084; DKFZp686I1383; |
Gene ID | 6295 |
mRNA Refseq | NM_000541 |
Protein Refseq | NP_000532 |
MIM | 181031 |
UniProt ID | P10523 |
◆ Recombinant Proteins | ||
SAG-5225R | Recombinant Rat SAG Protein | +Inquiry |
SAG-301320H | Recombinant Human SAG protein, GST-tagged | +Inquiry |
SAG-1950H | Recombinant Human SAG Protein, His (Fc)-Avi-tagged | +Inquiry |
SAG-2971H | Recombinant Human SAG protein, GST-tagged | +Inquiry |
SAG-6236H | Recombinant Human SAG Protein (Ala139-Lys388), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAG Products
Required fields are marked with *
My Review for All SAG Products
Required fields are marked with *
0
Inquiry Basket