| Cat. No.: | IL17A-113H |
| Product Overview: | Recombinant Human Interleukin 17A encoding the human IL-17A protein sequence (containing the signalpeptide sequence, and the mature IL-17A sequence) was expressed in modified human293 cells. |
| Description: | Interleukin-17 (IL-17) is a 155 amino acid protein that is a disulfide linked, homodimeric,secreted glycoprotein with one N-linked glycosylation site. IL-17 is also referred to as IL-17A. Other members include IL-17B, IL-17C, IL-17D, IL-17E and IL-17F. IL-17 binds tothe cell surfacer receptor IL-17R. IL-17 is secreted by a subset of T cells called T-helper 17 (Th-17) cells. IL-23 is thought to mediate the production of IL-17 by Th-17 cells. |
| Source: | Human 293 cells. |
| Amino Acid Sequence: | GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA. |
| Molecular Mass: | Under reducing conditions Apollo IL-17A hcx migrates as two bands at approximately 16and 22 kDa on SDS-PAGE due to post-translational modifications. |
| pI: | Apollo IL-17A hcx has a predicted pI of 8.62. |
| Glycosylation: | Apollo IL-17A hcx contains N--linked oligosaccharides. |
| Purity: | >95%, as determined by SDS-PAGE, visualised by Coomassie Brilliant Blue. |
| Formulation: | When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose. |
| Reconstitution: | It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. |
| Storage: | Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-termstorage at 4°C and longer-term storage of aliquots at -18 to -20°C is recommended. Repeated freeze thawing is not recommended. |
| Activity: | The activity of IL-17A is measured by its ability to induce IL-6 production in NHDF cells. The ED50is typically between 0.5 and 1.5 ng/ml. |
| Gene Name: | 17A interleukin 17A [ Homo sapiens ] |
| Synonyms: | IL17A; interleukin 17A; IL17; CTLA8; IL-17; IL-17A; toxic T-lymphocyte-associated antigen 8; otoxic T-lymphocyte-associated protein 8; cytotoxic T-lymphocyte-associated serine esterase 8; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8) |
| Gene ID: | 3605 |
| mRNA Refseq: | NM_002190 |
| Protein Refseq: | NP_002181 |
| UniProt ID: | Q16552 |
| Chromosome Location: | 6p12 |
| MIM: | 603149 |
| Pathway: | Cytokine-cytokine receptor interaction |
| Function: | cytokine activity |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All IL17A Products
Download Datasheet