Active Recombinant Human Interleukin 17A

• Cat.No.: IL17A-113H
• Product Overview: Recombinant Human Interleukin 17A encoding the human IL-17A protein sequence (containing the signalpeptide sequence, and the mature IL-17A sequence) was expressed in modified human293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Non
• Description: Interleukin-17 (IL-17) is a 155 amino acid protein that is a disulfide linked, homodimeric,secreted glycoprotein with one N-linked glycosylation site. IL-17 is also referred to as IL-17A. Other members include IL-17B, IL-17C, IL-17D, IL-17E and IL-17F. IL-17 binds tothe cell surfacer receptor IL-17R. IL-17 is secreted by a subset of T cells called T-helper 17 (Th-17) cells. IL-23 is thought to mediate the production of IL-17 by Th-17 cells.
• Amino Acid Sequence: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA.
• Molecular Mass: Under reducing conditions Apollo IL-17A hcx migrates as two bands at approximately 16and 22 kDa on SDS-PAGE due to post-translational modifications.
• pI: Apollo IL-17A hcx has a predicted pI of 8.62.
• Glycosylation: Apollo IL-17A hcx contains N--linked oligosaccharides.
• Purity: >95%, as determined by SDS-PAGE, visualised by Coomassie Brilliant Blue.
• Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
• Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
• Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-termstorage at 4°C and longer-term storage of aliquots at -18 to -20°C is recommended. Repeated freeze thawing is not recommended.
• Activity: The activity of IL-17A is measured by its ability to induce IL-6 production in NHDF cells. The ED₅₀is typically between 0.5 and 1.5 ng/ml.

Gene Information

• Gene Name: 17A interleukin 17A [ Homo sapiens ]
• Synonyms: IL17A; interleukin 17A; IL17; CTLA8; IL-17; IL-17A; toxic T-lymphocyte-associated antigen 8; otoxic T-lymphocyte-associated protein 8; cytotoxic T-lymphocyte-associated serine esterase 8; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8)
• Gene ID: 3605
• mRNA Refseq: NM_002190
• Protein Refseq: NP_002181
• UniProt ID: Q16552
• Chromosome Location: 6p12
• MIM: 603149
• Pathway: Cytokine-cytokine receptor interaction
• Function: cytokine activity