Active Recombinant Human Interleukin 17A

Cat.No. : IL17A-113H
Product Overview : Recombinant Human Interleukin 17A encoding the human IL-17A protein sequence (containing the signalpeptide sequence, and the mature IL-17A sequence) was expressed in modified human293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Non
Description : Interleukin-17 (IL-17) is a 155 amino acid protein that is a disulfide linked, homodimeric,secreted glycoprotein with one N-linked glycosylation site. IL-17 is also referred to as IL-17A. Other members include IL-17B, IL-17C, IL-17D, IL-17E and IL-17F. IL-17 binds tothe cell surfacer receptor IL-17R. IL-17 is secreted by a subset of T cells called T-helper 17 (Th-17) cells. IL-23 is thought to mediate the production of IL-17 by Th-17 cells.
Amino Acid Sequence : GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA.
Molecular Mass : Under reducing conditions Apollo IL-17A hcx migrates as two bands at approximately 16and 22 kDa on SDS-PAGE due to post-translational modifications.
pI : Apollo IL-17A hcx has a predicted pI of 8.62.
Glycosylation : Apollo IL-17A hcx contains N--linked oligosaccharides.
Purity : >95%, as determined by SDS-PAGE, visualised by Coomassie Brilliant Blue.
Formulation : When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution : It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage : Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-termstorage at 4°C and longer-term storage of aliquots at -18 to -20°C is recommended. Repeated freeze thawing is not recommended.
Activity : The activity of IL-17A is measured by its ability to induce IL-6 production in NHDF cells. The ED50is typically between 0.5 and 1.5 ng/ml.
Gene Name 17A interleukin 17A [ Homo sapiens ]
Synonyms IL17A; interleukin 17A; IL17; CTLA8; IL-17; IL-17A; toxic T-lymphocyte-associated antigen 8; otoxic T-lymphocyte-associated protein 8; cytotoxic T-lymphocyte-associated serine esterase 8; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8)
Gene ID 3605
mRNA Refseq NM_002190
Protein Refseq NP_002181
UniProt ID Q16552
Chromosome Location 6p12
MIM 603149
Pathway Cytokine-cytokine receptor interaction
Function cytokine activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL17A Products

Required fields are marked with *

My Review for All IL17A Products

Required fields are marked with *

0
cart-icon
0
compare icon