Active Recombinant Human IL17A Protein
Cat.No. : | IL17A-137H |
Product Overview : | Recombinant Human IL17A Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Interleukin 17A (IL-17A), also known as CTLA-8, is a member of the IL-17 family of proteins. |
Bio-activity : | Production of IL-6 from mouse 3T3 cells, ≤10 ng/mL |
AA Sequence : | MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Gene Name | IL17A interleukin 17A [ Homo sapiens (human) ] |
Official Symbol | IL17A |
Synonyms | IL17A; interleukin 17A; CTLA8, IL17, interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8); interleukin-17A; cytotoxic T lymphocyte associated protein 8; IL 17; IL 17A; CTLA-8; cytotoxic T-lymphocyte-associated antigen 8; cytotoxic T-lymphocyte-associated protein 8; cytotoxic T-lymphocyte-associated serine esterase 8; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); IL17; CTLA8; IL-17; IL-17A; |
Gene ID | 3605 |
mRNA Refseq | NM_002190 |
Protein Refseq | NP_002181 |
MIM | 603149 |
UniProt ID | Q16552 |
◆ Recombinant Proteins | ||
IL17A-432P | Recombinant Pig IL17A protein, His&Myc-tagged | +Inquiry |
IL17A-307H | Active Recombinant Human IL17A protein | +Inquiry |
IL17A-056C | Recombinant Cynomolgus IL17A protein, His-Avi-tagged | +Inquiry |
IL17A-381HB | Recombinant Human IL17A protein, His-Avi-tagged, Biotinylated | +Inquiry |
Il17a-094M | Active Recombinant Mouse Il17a Protein | +Inquiry |
◆ Native Proteins | ||
IL17A-048H | Active Glycosylated Recombinant Human IL17A Homodimer | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17A-001HCL | Recombinant Human IL17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL17A Products
Required fields are marked with *
My Review for All IL17A Products
Required fields are marked with *