"ADAM17" Related Products

Expand
Expand
Expand

Recombinant Human ADAM17

Cat.No.: ADAM17-26135TH
Product Overview: Recombinant fragment (amino acids 215-314) of Human ADAM17 with a proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag.
Description: This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biologic processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene functions as a tumor necrosis factor-alpha converting enzyme; binds mitotic arrest deficient 2 protein; and also plays a prominent role in the activation of the Notch signaling pathway.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Ubiquitously expressed. Expressed at highest levels in adult heart, placenta, skeletal muscle, pancreas, spleen, thymus, prostate, testes, ovary and small intestine, and in fetal brain, lung, liver and kidney.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: RADPDPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDV
Sequence Similarities: Contains 1 disintegrin domain.Contains 1 peptidase M12B domain.
Gene Name: ADAM17 ADAM metallopeptidase domain 17 [ Homo sapiens ]
Official Symbol: ADAM17
Synonyms: ADAM17; ADAM metallopeptidase domain 17; TACE, tumor necrosis factor, alpha, converting enzyme; disintegrin and metalloproteinase domain-containing protein 17; CD156B; cSVP;
Gene ID: 6868
mRNA Refseq: NM_003183
Protein Refseq: NP_003174
MIM: 603639
Uniprot ID: P78536
Chromosome Location: 2p25
Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Epithelial cell signaling in Helicobacter pylori infection, organism-specific biosystem;
Function: PDZ domain binding; SH3 domain binding; integrin binding; interleukin-6 receptor binding; metal ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.