"AKR1B10" Related Products

Expand

Recombinant Human AKR1B10

Cat.No.: AKR1B10-27154TH
Product Overview: Recombinant full length Human AKR1B10 protein , 36 kDa.
Description: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.
Protein length: 316 amino acids
Molecular Weight: 36.000kDa
Source: E. coli
Tissue specificity: Found in many tissues. Highly expressed in small intestine, colon and adrenal gland.
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol
Storage: Please see Notes section
Sequences of amino acids: MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGY RHIDCAYVYQNEHEVGEAIQEKIQEKAVKREDLFIVSKLW PTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGD DLFPKDDKGNAIGGKATFLDAWEAMEELVDEGLVKALGVS NFSHFQIEKLLNKPGLKYKPVTNQVECHPYLTQEKLIQYC HSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAK HKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFK LSDEEMATILSFNRNWRACNVLQSSHLEDYPFDAEY
Sequence Similarities: Belongs to the aldo/keto reductase family.
Gene Name: AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) [ Homo sapiens ]
Official Symbol: AKR1B10
Synonyms: AKR1B10; aldo-keto reductase family 1, member B10 (aldose reductase); AKR1B11; aldo-keto reductase family 1 member B10; AKR1B12; aldo keto reductase family 1; member B11 (aldose reductase like); aldose reductase like 1; aldose reductase like peptide; aldo
Gene ID: 57016
mRNA Refseq: NM_020299
Protein Refseq: NP_064695
MIM: 604707
Uniprot ID: O60218
Chromosome Location: 7q33
Pathway: Butanoate metabolism, organism-specific biosystem; Butanoate metabolism, conserved biosystem; Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Linoleic acid metabolism, organism-specific biosystem;
Function: aldo-keto reductase (NADP) activity; oxidoreductase activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.