Recombinant Human CLDN3
Cat.No. : | CLDN3-27271TH |
Product Overview : | Recombinant full length Human Claudin 3 with an N terminal proprietary tag; Predicted MWt 50.31 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 220 amino acids |
Description : | Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this intronless gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is also a low-affinity receptor for Clostridium perfringens enterotoxin, and shares aa sequence similarity with a putative apoptosis-related protein found in rat. |
Molecular Weight : | 50.310kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNII TSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR ALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVA GVLFLLAALLTLVPVSWSANTIIRDFYNPVVPEAQKREMG AGLYVGWAAAALQLLGGALLCCSCPPREKKYTATKVVYSA PRSTGPGASLGTGYDRKDYV |
Sequence Similarities : | Belongs to the claudin family. |
Gene Name | CLDN3 claudin 3 [ Homo sapiens ] |
Official Symbol | CLDN3 |
Synonyms | CLDN3; claudin 3; C7orf1, CPETR2; claudin-3; Clostridium perfringens enterotoxin receptor 2; CPE R2; CPE receptor 2; HRVP1; RVP1; ventral prostate.1 like protein; |
Gene ID | 1365 |
mRNA Refseq | NM_001306 |
Protein Refseq | NP_001297 |
MIM | 602910 |
Uniprot ID | O15551 |
Chromosome Location | 7q11 |
Pathway | Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; |
Function | identical protein binding; structural molecule activity; transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
RFL16043BF | Recombinant Full Length Bovine Claudin-3(Cldn3) Protein, His-Tagged | +Inquiry |
CLDN3-1537H | Recombinant Human CLDN3 Full Length Transmembrane protein, His-tagged | +Inquiry |
CLDN3-0332H | Recombinant Human CLDN3 Protein (Met1-Val220), C-His-tagged | +Inquiry |
CLDN3-1442H | Recombinant Human CLDN3 Protein, GST-tagged | +Inquiry |
CLDN3-11295H | Recombinant Human CLDN3, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN3-7463HCL | Recombinant Human CLDN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLDN3 Products
Required fields are marked with *
My Review for All CLDN3 Products
Required fields are marked with *
0
Inquiry Basket