"GPX1" Related Products

Expand
Expand

Recombinant Human GPX1, His-tagged

Cat.No.: GPX1-29074TH
Product Overview: Recombinant full length Human Glutathione Peroxidase 1 with an N terminal His tag ; mwt: 24.2 kDa.
Description: This gene encodes a member of the glutathione peroxidase family. Glutathione peroxidase functions in the detoxification of hydrogen peroxide, and is one of the most important antioxidant enzymes in humans. This protein is one of only a few proteins known in higher vertebrates to contain selenocysteine, which occurs at the active site of glutathione peroxidase and is coded by UGA, that normally functions as a translation termination codon. In addition, this protein is characterized in a polyalanine sequence polymorphism in the N-terminal region, which includes three alleles with five, six or seven alanine (ALA) repeats in this sequence. The allele with five ALA repeats is significantly associated with breast cancer risk. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Protein length: 203 amino acids
Conjugation: HIS
Molecular Weight: 24.200kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 30% Glycerol, 0.04% DTT, 0.58% Sodium chloride
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLCGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA
Sequence Similarities: Belongs to the glutathione peroxidase family.
Gene Name: GPX1 glutathione peroxidase 1 [ Homo sapiens ]
Official Symbol: GPX1
Synonyms: GPX1; glutathione peroxidase 1;
Gene ID: 2876
mRNA Refseq: NM_000581
Protein Refseq: NP_000572
MIM: 138320
Uniprot ID: P07203
Chromosome Location: 3p21.3
Pathway: Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Direct p53 effectors, organism-specific biosystem;
Function: SH3 domain binding; endopeptidase inhibitor activity; glutathione peroxidase activity; glutathione peroxidase activity; oxidoreductase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.