Recombinant Human GPX1 protein, His-SUMO-tagged
Cat.No. : | GPX1-2990H |
Product Overview : | Recombinant Human GPX1 protein(P07203)(1-203aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-203aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38.1 kDa |
AA Sequence : | MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLSGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GPX1 glutathione peroxidase 1 [ Homo sapiens ] |
Official Symbol | GPX1 |
Synonyms | GPX1; glutathione peroxidase 1; GPx-1; GSHPx-1; cellular glutathione peroxidase; GPXD; GSHPX1; MGC14399; MGC88245; |
Gene ID | 2876 |
mRNA Refseq | NM_000581 |
Protein Refseq | NP_000572 |
MIM | 138320 |
UniProt ID | P07203 |
◆ Recombinant Proteins | ||
GPX1-2990H | Recombinant Human GPX1 protein, His-SUMO-tagged | +Inquiry |
GPX1-5202C | Recombinant Chicken GPX1 | +Inquiry |
GPX1-29073TH | Recombinant Human GPX1, His-tagged | +Inquiry |
GPX1-2677R | Recombinant Rat GPX1 Protein | +Inquiry |
GPX1-29074TH | Recombinant Human GPX1, His-tagged | +Inquiry |
◆ Native Proteins | ||
GPX1-8429H | Native Human GPX1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPX1-5763HCL | Recombinant Human GPX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPX1 Products
Required fields are marked with *
My Review for All GPX1 Products
Required fields are marked with *