"IRAK1" Related Products

Expand

Recombinant Human IRAK1

Cat.No.: IRAK1-27500TH
Product Overview: Recombinant full length Human IRAK with an N terminal proprietary tag; Predicted MWt 95.7 kDa.
Description: This gene encodes the interleukin-1 receptor-associated kinase 1, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. This gene is partially responsible for IL1-induced upregulation of the transcription factor NF-kappa B. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein length: 633 amino acids
Molecular Weight: 95.700kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Isoform 1 and isoform 2 are ubiquitously expressed in all tissues examined, with isoform 1 being more strongly expressed than isoform 2.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPA DWCQFAALIVRDQTELRLCERSGQRTASVLWPWINRNARV ADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSS IPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHSGPELGL VPSPASLWPPPPSPAPSSTKPGPESSVSLLQGARPSPFCW PLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKR LKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQ NGFYCLVYGFLPNGSLEDRLHCQTQACPPLSWPQRLDILL GTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDFG LARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGR LAVDTDTFSFGVVVLETLAGQRAVKTHGARTKYLVYERLE KLQAVVAGVPGHLEAASCIPPSPQENSYVSSTGRAHSGAA PWQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAAL RSWHLTPSCPLDPAPLREAGCPQGDTAGESSWGSGPGSRP TAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDG ALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS
Sequence Similarities: Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. Pelle subfamily.Contains 1 protein kinase domain.
Gene Name: IRAK1 interleukin-1 receptor-associated kinase 1 [ Homo sapiens ]
Official Symbol: IRAK1
Synonyms: IRAK1; interleukin-1 receptor-associated kinase 1; IRAK; pelle;
Gene ID: 3654
mRNA Refseq: NM_001569
Protein Refseq: NP_001560
MIM: 300283
Uniprot ID: P51617
Chromosome Location: Xq28
Pathway: Activated TLR4 signalling, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem;
Function: ATP binding; NF-kappaB-inducing kinase activity; interleukin-1 receptor binding; kinase activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.