Recombinant Human IRAK1 Protein, His tagged

• Cat.No.: IRAK1-1542H
• Product Overview: Recombinant Human IRAK1 Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: This gene encodes the interleukin-1 receptor-associated kinase 1, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. This gene is partially responsible for IL1-induced upregulation of the transcription factor NF-kappa B. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: The protein has a calculated MW of 12 kDa.
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMAGCPQGDTAGESSWGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.8 mg/mL by BCA
• Storage Buffer: Sterile 100 mM PB, 500 mM NaCl, 25 mM Imidazole, 10% Glycerol, pH 7.4

Gene Information

• Gene Name: IRAK1 interleukin-1 receptor-associated kinase 1 [ Homo sapiens ]
• Official Symbol: IRAK1
• Synonyms: IRAK1; interleukin-1 receptor-associated kinase 1; IRAK; pelle; IRAK-1; Pelle homolog
• Gene ID: 3654
• mRNA Refseq: NM_001025242
• Protein Refseq: NP_001020413
• MIM: 300283
• UniProt ID: P51617