Recombinant Human IRAK1 Protein, His tagged

Cat.No. : IRAK1-1542H
Product Overview : Recombinant Human IRAK1 Protein with His tag was expressed in E. coli.
Availability June 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes the interleukin-1 receptor-associated kinase 1, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. This gene is partially responsible for IL1-induced upregulation of the transcription factor NF-kappa B. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : The protein has a calculated MW of 12 kDa.
AA Sequence : MGSSHHHHHHSSGLVPRGSHMAGCPQGDTAGESSWGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.8 mg/mL by BCA
Storage Buffer : Sterile 100 mM PB, 500 mM NaCl, 25 mM Imidazole, 10% Glycerol, pH 7.4
Gene Name IRAK1 interleukin-1 receptor-associated kinase 1 [ Homo sapiens ]
Official Symbol IRAK1
Synonyms IRAK1; interleukin-1 receptor-associated kinase 1; IRAK; pelle; IRAK-1; Pelle homolog;
Gene ID 3654
mRNA Refseq NM_001025242
Protein Refseq NP_001020413
MIM 300283
UniProt ID P51617

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IRAK1 Products

Required fields are marked with *

My Review for All IRAK1 Products

Required fields are marked with *

0
cart-icon