Recombinant Human IRAK1 Protein, His tagged
| Cat.No. : | IRAK1-1542H |
| Product Overview : | Recombinant Human IRAK1 Protein with His tag was expressed in E. coli. |
| Availability | December 06, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | This gene encodes the interleukin-1 receptor-associated kinase 1, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. This gene is partially responsible for IL1-induced upregulation of the transcription factor NF-kappa B. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Molecular Mass : | The protein has a calculated MW of 12 kDa. |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMAGCPQGDTAGESSWGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.8 mg/mL by BCA |
| Storage Buffer : | Sterile 100 mM PB, 500 mM NaCl, 25 mM Imidazole, 10% Glycerol, pH 7.4 |
| Gene Name | IRAK1 interleukin-1 receptor-associated kinase 1 [ Homo sapiens ] |
| Official Symbol | IRAK1 |
| Synonyms | IRAK1; interleukin-1 receptor-associated kinase 1; IRAK; pelle; IRAK-1; Pelle homolog; |
| Gene ID | 3654 |
| mRNA Refseq | NM_001025242 |
| Protein Refseq | NP_001020413 |
| MIM | 300283 |
| UniProt ID | P51617 |
| ◆ Recombinant Proteins | ||
| IRAK1-2647H | Recombinant Human IRAK1 Protein (Phe212-Leu434), N-His tagged | +Inquiry |
| IRAK1-5056H | Recombinant Human IRAK1 Protein, GST-tagged | +Inquiry |
| Irak1-1243M | Recombinant Mouse Irak1 Protein, MYC/DDK-tagged | +Inquiry |
| IRAK1-799H | Recombinant Human IRAK1 Protein, GST/His-tagged | +Inquiry |
| IRAK1-1200H | Recombinant Human IRAK1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IRAK1-5173HCL | Recombinant Human IRAK1 293 Cell Lysate | +Inquiry |
| IRAK1-5174HCL | Recombinant Human IRAK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRAK1 Products
Required fields are marked with *
My Review for All IRAK1 Products
Required fields are marked with *
