Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human IRAK1

Cat.No. : IRAK1-27502TH
Product Overview : Recombinant fragment, corresponding to amino acids 530-693 of Human IRAK with an N terminal proprietary tag; Predicted MWt 43.45 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes the interleukin-1 receptor-associated kinase 1, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. This gene is partially responsible for IL1-induced upregulation of the transcription factor NF-kappa B. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein length : 164 amino acids
Molecular Weight : 43.450kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Isoform 1 and isoform 2 are ubiquitously expressed in all tissues examined, with isoform 1 being more strongly expressed than isoform 2.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SSTGRAHSGAAPWQPLAAPSGASAQAAEQLQRGPNQPVES DESLGGLSAALRSWHLTPSCPLDPAPLREAGCPQGDTAGE SSWGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQK MVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESD EFQS
Sequence Similarities : Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. Pelle subfamily.Contains 1 protein kinase domain.
Gene Name : IRAK1 interleukin-1 receptor-associated kinase 1 [ Homo sapiens ]
Official Symbol : IRAK1
Synonyms : IRAK1; interleukin-1 receptor-associated kinase 1; IRAK; pelle;
Gene ID : 3654
mRNA Refseq : NM_001569
Protein Refseq : NP_001560
MIM : 300283
Uniprot ID : P51617
Chromosome Location : Xq28
Pathway : Activated TLR4 signalling, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem;
Function : ATP binding; NF-kappaB-inducing kinase activity; interleukin-1 receptor binding; kinase activity; nucleotide binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends