Recombinant Active Mouse IL1A Protein, His-tagged(C-ter)
Cat.No. : | Il1a-158M |
Product Overview : | Recombinant Active Mouse IL1A Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease. [provided by RefSeq, Jul 2008] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce D10.G4.1 cells proliferation. The ED50 for this effect is < 5 pg/ml. The specific activity of recombinant mouse IL-1 alpha is > 2 x 10^8 IU/mg. |
AA Sequence : | MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 95% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 7.4) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | Il1a interleukin 1 alpha [ Mus musculus ] |
Official Symbol | Il1a |
Synonyms | IL1A; interleukin 1 alpha; interleukin-1 alpha; IL-1 alpha; Il-1a; |
Gene ID | 16175 |
mRNA Refseq | NM_010554 |
Protein Refseq | NP_034684 |
◆ Recombinant Proteins | ||
IL1A-83R | Recombinant Rhesus IL1A protein | +Inquiry |
IL1a-46C | Recombinant Canine IL-1 alpha | +Inquiry |
IL1A-131H | Active Recombinant Human IL1A protein | +Inquiry |
IL1A-1017H | Recombinant Human IL1A Protein, His-tagged | +Inquiry |
Il1a-099M | Active Recombinant Mouse Il1a Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1A-2911HCL | Recombinant Human IL1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL1A Products
Required fields are marked with *
My Review for All IL1A Products
Required fields are marked with *
0
Inquiry Basket