Recombinant Canine IL-1 beta

Cat.No. : Il1b-25C
Product Overview : Canine IL-1 beta was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Canine
Source : Yeast
Tag : Non
Description : The IL-1 family of cytokines encompasses eleven proteins that each share a similar β-barrel structure and bind to Ig-like receptors. Several of the well characterized members of the IL-1-like cytokines play key roles in the development and regulation of inflammation. IL-1α (IL-1F1), IL-1β (IL-1F2), and IL-18 (IL-1F4) are well-known inflammatory cytokines active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. In contrast, IL-1 receptor antagonist (IL-1ra; IL-1F3) and IL-36 receptor antagonist (IL-36ra; IL-1F5) reduce inflammation by blocking the binding of the agonist receptor ligands. IL-33 (IL-1F11) is thought to function as an "alarmin" released following cell necrosis to alerting the immune system to tissue damage or stress. The biological properties of IL-37 (IL-1F7) are mainly those of down-regulating inflammation.
Form : Lyophilized
Molecular Mass : 17.5 kDa
AA Sequence : AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKD GKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEF SS
Applications : The Canine IL-1 beta protein can be used in cell culture, as an IL-1 beta ELISA Standard, and as a Western Blot Control.
Storage : -20 C

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il1b Products

Required fields are marked with *

My Review for All Il1b Products

Required fields are marked with *

0
cart-icon