Recombinant Dog SAA1 Protein, His-GST-tagged

Cat.No. : SAA1-1364D
Product Overview : Recombinant Dog SAA1 Protein (19-129aa) was expressed in E. coli with N-terminal His-GST tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Dog
Source : E.coli
Tag : GST&His
Protein Length : 19-129 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 42.5 kDa
AA Sequence : QWYSFVSEAAQGAWDMWRAYSDMREANYKNSDKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRITDL
LRFGDSGHGAEDSKADQAANEWGRSGKDPNHFRPAGLPDKY
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name SAA1 serum amyloid A1 [ Canis lupus familiaris (dog) ]
Official Symbol SAA1
Synonyms SAA; SAA1; serum amyloid A protein-like; Serum amyloid A protein
Gene ID 751814
mRNA Refseq NM_001313872.1
Protein Refseq NP_001300801.1
UniProt ID P19708

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SAA1 Products

Required fields are marked with *

My Review for All SAA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon