Recombinant Cat SAA1 Protein, His-B2M-tagged

Cat.No. : SAA1-1363C
Product Overview : Recombinant Cat SAA1 Protein (1-90aa) was expressed in E. coli with N-terminal His-B2M tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Cat
Source : E.coli
Tag : B2M&His
Protein Length : 1-90 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 24.1 kDa
AA Sequence : EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDF
FRHGNSGHGAEDSKADQEWG
Purity : >97% as determined by SDS-PAGE and HPLC.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name LOC101099498 serum amyloid A protein-like [ Felis catus (domestic cat) ]
Official Symbol SAA1
Synonyms SAA; SAA1; serum amyloid A protein-like; Serum amyloid A protein
Gene ID 101099498
UniProt ID P19707

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SAA1 Products

Required fields are marked with *

My Review for All SAA1 Products

Required fields are marked with *

0
cart-icon