Recombinant Cat SAA1 Protein, His-B2M-tagged
Cat.No. : | SAA1-1363C |
Product Overview : | Recombinant Cat SAA1 Protein (1-90aa) was expressed in E. coli with N-terminal His-B2M tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cat |
Source : | E.coli |
Tag : | B2M&His |
Protein Length : | 1-90 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 24.1 kDa |
AA Sequence : | EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDF FRHGNSGHGAEDSKADQEWG |
Purity : | >97% as determined by SDS-PAGE and HPLC. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | LOC101099498 serum amyloid A protein-like [ Felis catus (domestic cat) ] |
Official Symbol | SAA1 |
Synonyms | SAA; SAA1; serum amyloid A protein-like; Serum amyloid A protein |
Gene ID | 101099498 |
UniProt ID | P19707 |
◆ Recombinant Proteins | ||
SAA1-71M | Recombinant Full Length Mouse SAA1 Protein | +Inquiry |
SAA1-14633M | Recombinant Mouse SAA1 Protein | +Inquiry |
SAA1-31162TH | Recombinant Human SAA1 | +Inquiry |
SAA1-795H | Recombinant Horse SAA1 Protein (1-110 aa), His-tagged | +Inquiry |
SAA1-2345H | Recombinant Horse SAA1 Protein (1-110 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAA1-2080HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
SAA1-2081HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAA1 Products
Required fields are marked with *
My Review for All SAA1 Products
Required fields are marked with *