Recombinant Cat SAA1 Protein, His-B2M-tagged
| Cat.No. : | SAA1-1363C |
| Product Overview : | Recombinant Cat SAA1 Protein (1-90aa) was expressed in E. coli with N-terminal His-B2M tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cat |
| Source : | E.coli |
| Tag : | B2M&His |
| Protein Length : | 1-90 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 24.1 kDa |
| AA Sequence : | EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDF FRHGNSGHGAEDSKADQEWG |
| Purity : | >97% as determined by SDS-PAGE and HPLC. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | LOC101099498 serum amyloid A protein-like [ Felis catus (domestic cat) ] |
| Official Symbol | SAA1 |
| Synonyms | SAA; SAA1; serum amyloid A protein-like; Serum amyloid A protein |
| Gene ID | 101099498 |
| UniProt ID | P19707 |
| ◆ Recombinant Proteins | ||
| SAA1-1363C | Recombinant Cat SAA1 Protein, His-B2M-tagged | +Inquiry |
| SAA1-5110H | Recombinant Human Serum Amyloid A1, His-tagged | +Inquiry |
| SAA1-5197R | Recombinant Rhesus SAA1 protein | +Inquiry |
| SAA1-6231H | Recombinant Human SAA1 Protein (Ser20-Tyr122), N-His tagged | +Inquiry |
| Saa1-7876M | Recombinant Mouse Saa1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SAA1-2080HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
| SAA1-2081HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAA1 Products
Required fields are marked with *
My Review for All SAA1 Products
Required fields are marked with *
