Recombinant Bovine SAA1 protein, His-SUMO & Myc-tagged
Cat.No. : | SAA1-3467B |
Product Overview : | Recombinant Bovine SAA1 protein(P35541)(19-130aa), fused to N-terminal His-SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 19-130aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.1 kDa |
AA Sequence : | QWMSFFGEAYEGAKDMWRAYSDMREANYKGADKYFHARGNYDAAQRGPGGAWAAKVISDARENIQRFTDPLFKGTTSGQGQEDSRADQAANEWGRSGKDPNHFRPAGLPDKY |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
SAA1-795H | Recombinant Horse SAA1 Protein (1-110 aa), His-tagged | +Inquiry |
Saa1-3468M | Recombinant Mouse Saa1 protein, His-SUMO-tagged | +Inquiry |
SAA1-1012H | Recombinant Human SAA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SAA1-6232H | Recombinant Full Length Human SAA1 Protein (Met1-Tyr122), C-His tagged | +Inquiry |
SAA1-3467B | Recombinant Bovine SAA1 protein, His-SUMO & Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAA1-2080HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
SAA1-2081HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAA1 Products
Required fields are marked with *
My Review for All SAA1 Products
Required fields are marked with *
0
Inquiry Basket