Recombinant Human ADAMTS13

Cat.No. : ADAMTS13-26136TH
Product Overview : Recombinant fragment corresponding to amino acids 1328-1427 of Human ADAMTS13 with a propreitary tag at N-terminal; predicted mwt: 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 1328-1427 a.a.
Description : This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene is the von Willebrand Factor (vWF)-cleaving protease, which is responsible for cleaving at the site of Tyr842-Met843 of the vWF molecule. A deficiency of this enzyme is associated with thrombotic thrombocytopenic purpura. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Plasma. Expressed primarily in liver.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVLYWESESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT
Sequence Similarities : Contains 2 CUB domains.Contains 1 disintegrin domain.Contains 1 peptidase M12B domain.Contains 8 TSP type-1 domains.
Gene Name ADAMTS13 ADAM metallopeptidase with thrombospondin type 1 motif, 13 [ Homo sapiens ]
Official Symbol ADAMTS13
Synonyms ADAMTS13; ADAM metallopeptidase with thrombospondin type 1 motif, 13; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13 , C9orf8; A disintegrin and metalloproteinase with thrombospondin motifs 13; DKFZp434C2322;
Gene ID 11093
mRNA Refseq NM_139025
Protein Refseq NP_620594
MIM 604134
Uniprot ID Q76LX8
Chromosome Location 9q34
Function calcium ion binding; integrin binding; metalloendopeptidase activity; metallopeptidase activity; metallopeptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADAMTS13 Products

Required fields are marked with *

My Review for All ADAMTS13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon