Recombinant Human ADAMTS13 Protein, GST-tagged
| Cat.No. : | ADAMTS13-299H |
| Product Overview : | Human ADAMTS13 partial ORF ( NP_620594, 1328 a.a. - 1427 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of a family of proteins containing several distinct regions, including a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. The enzyme encoded by this gene specifically cleaves von Willebrand Factor (vWF). Defects in this gene are associated with thrombotic thrombocytopenic purpura. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | FINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVLYWESESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ADAMTS13 ADAM metallopeptidase with thrombospondin type 1 motif, 13 [ Homo sapiens ] |
| Official Symbol | ADAMTS13 |
| Synonyms | ADAMTS13; ADAM metallopeptidase with thrombospondin type 1 motif, 13; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13 , C9orf8; A disintegrin and metalloproteinase with thrombospondin motifs 13; DKFZp434C2322; FLJ42993; MGC118899; MGC118900; TTP; vWF CP; VWFCP; ADAM-TS 13; vWF-cleaving protease; von Willebrand factor-cleaving protease; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13; 13; C9orf8; vWF-CP; ADAM-TS; ADAM-TS13; ADAMTS-13; |
| Gene ID | 11093 |
| mRNA Refseq | NM_139025 |
| Protein Refseq | NP_620594 |
| MIM | 604134 |
| UniProt ID | Q76LX8 |
| ◆ Recombinant Proteins | ||
| ADAMTS13-1432H | Recombinant Human ADAMTS13 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ADAMTS13-137H | Recombinant Human ADAMTS13, MYC/DDK-tagged | +Inquiry |
| ADAMTS13-26136TH | Recombinant Human ADAMTS13 | +Inquiry |
| Adamts13-2322M | Recombinant Mouse Adamts13 protein, hFc-tagged | +Inquiry |
| ADAMTS13-2184M | Recombinant Mouse ADAMTS13 protein(904-1137aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAMTS13 Products
Required fields are marked with *
My Review for All ADAMTS13 Products
Required fields are marked with *
