Recombinant Mouse ADAMTS13 Protein (904-1137 aa), His-Myc-tagged
Cat.No. : | ADAMTS13-2684M |
Product Overview : | Recombinant Mouse ADAMTS13 Protein (904-1137 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cancer. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 904-1137 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 32.7 kDa |
AA Sequence : | WTPLVGLCSISCGRGLKELYFLCMDSVLKMPVQEELCGLASKPPSRWEVCRARPCPARWETQVLAPCPVTCGGGRVPLSVRCVQLDRGHPISVPHSKCSPVPKPGSFEDCSPEPCPARWKVLSLGPCSASCGLGTATQMVACMQLDQGHDNEVNETFCKALVRPQASVPCLIADCAFRWHISAWTECSVSCGDGIQRRHDTCLGPQAQVPVPANFCQHLPKPMTVRGCWAGPCA |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Adamts13 a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 13 [ Mus musculus ] |
Official Symbol | ADAMTS13 |
Synonyms | ADAMTS13; ADAM-TS13; ADAMTS-13; ADAM-TS 13; vWF-cleaving protease; ADAMTS13 isoform IAP-b; Gm710; vWF-CP; |
Gene ID | 279028 |
mRNA Refseq | NM_001001322 |
Protein Refseq | NP_001001322 |
UniProt ID | Q769J6 |
◆ Recombinant Proteins | ||
Adamts13-1528M | Recombinant Mouse Adamts13 Protein, Myc/DDK-tagged | +Inquiry |
ADAMTS13-2184M | Recombinant Mouse ADAMTS13 protein(904-1137aa), His-tagged | +Inquiry |
ADAMTS13-26136TH | Recombinant Human ADAMTS13 | +Inquiry |
ADAMTS13-8232HFL | Recombinant Full Length Human ADAMTS13, Flag-tagged | +Inquiry |
ADAMTS13-2684M | Recombinant Mouse ADAMTS13 Protein (904-1137 aa), His-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADAMTS13 Products
Required fields are marked with *
My Review for All ADAMTS13 Products
Required fields are marked with *
0
Inquiry Basket