Recombinant Human AKR1B10

• Cat.No.: AKR1B10-27154TH
• Product Overview: Recombinant full length Human AKR1B10 protein , 36 kDa.

Specification

• Description: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.
• Protein length: 316 amino acids
• Molecular Weight: 36.000kDa
• Source: E. coli
• Tissue specificity: Found in many tissues. Highly expressed in small intestine, colon and adrenal gland.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol
• Storage: Please see Notes section
• Sequences of amino acids: MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGY RHIDCAYVYQNEHEVGEAIQEKIQEKAVKREDLFIVSKLW PTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGD DLFPKDDKGNAIGGKATFLDAWEAMEELVDEGLVKALGVS NFSHFQIEKLLNKPGLKYKPVTNQVECHPYLTQEKLIQYC HSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAK HKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFK LSDEEMATILSFNRNWRACNVLQSSHLEDYPFDAEY
• Sequence Similarities: Belongs to the aldo/keto reductase family.
• Tag: Non

Gene Information

• Gene Name: AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) [ Homo sapiens ]
• Official Symbol: AKR1B10
• Synonyms: AKR1B10; aldo-keto reductase family 1, member B10 (aldose reductase); AKR1B11; aldo-keto reductase family 1 member B10; AKR1B12; aldo keto reductase family 1; member B11 (aldose reductase like); aldose reductase like 1; aldose reductase like peptide; aldo
• Gene ID: 57016
• mRNA Refseq: NM_020299
• Protein Refseq: NP_064695
• MIM: 604707
• Uniprot ID: O60218
• Chromosome Location: 7q33
• Pathway: Butanoate metabolism, organism-specific biosystem; Butanoate metabolism, conserved biosystem; Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Linoleic acid metabolism, organism-specific biosystem
• Function: aldo-keto reductase (NADP) activity; oxidoreductase activity; protein binding

Reviews

09/20/2022

Has therapeutic effects on specific disease models and is a promising candidate for new drugs.

03/31/2022

The laboratory personnel feedback that the protein is easy to operate, can meet the experimental needs, and has a good cost performance.

05/30/2019

It has been found to increase yield and purity and improve production efficiency in biotechnology production.

09/30/2018

Good fluorescence labeling performance in light microscopy technology, which is helpful for cell imaging studies.

Q&As

What are the methods for laboratory detection of AKR1B10 protein?

AKR1B10 protein is mainly detected in laboratory by enzyme-linked immunosorbent assay, fluorescence quantitative PCR and other methods.

Which cell signaling pathways does AKR1B10 protein participate in?

AKR1B10 is involved in a variety of cell signaling pathways, such as NF-κB, WNT/ β-catenin signaling pathways, and thus plays a role in cell proliferation, differentiation and apoptosis.

How does AKR1B10 play a role in neuroprotective mechanisms?

This protein is involved in the NADP/NADPH metabolic pathway, plays an antioxidant and neuroprotective role, and thus has a promising application in the prevention and treatment of central nervous system diseases.

AKR1B10 has the potential to be used in the early diagnosis and prevention of which cancers?

AKR1B10 has a certain application prospect in the early diagnosis and prognosis evaluation of lung cancer, colorectal cancer, liver cancer and other cancers.

How is AKR1B10 protein distributed in the human body

The AKR1B10 protein is an alcohol contraction enzyme that is associated with a variety of diseases and is mainly found in tissues such as liver, lung, stomach, breast, kidney, pancreas and intestine.

Does AKR1B10 have potential applications in the treatment of inflammatory diseases?

AKR1B10 inhibitors can be used to prevent and treat a variety of inflammatory diseases, such as rheumatoid arthritis and hepatitis B.

How does AKR1B10 function in lung cancer?

AKR1B10 protein is associated with cell proliferation, angiogenesis and malignant metastasis in lung cancer

In what diseases do AKR1B10 inhibitors have potential applications?

AKR1B10 inhibitors have potential anti-tumor and anti-inflammatory therapeutic effects and can be used in the treatment of lung cancer, breast cancer, diabetes and other diseases.

Whether AKR1B10 protein is involved in tumorigenesis?

The expression level of AKR1B10 protein in tumor cells is increased, which is related to tumor proliferation, invasion and metastasis, and is a new tumor biomarker.

What is the role of AKR1B10 protein in metabolic diseases?

AKR1B10 is involved in the occurrence and development of metabolic diseases, such as diabetes and obesity, and is a possible therapeutic target.

Whether AKR1B10 protein has a function in the human body

AKR1B10 protein is involved in various metabolic processes and cell proliferation and growth, such as steroid hormone metabolism, fatty acid synthesis, cell cycle regulation and so on.

Does there any steroid hormone metabolic pathways involved in AKR1B10?

The metabolic pathways of steroid hormones involved in AKR1B10 include oxidative metabolism and reductive metabolism of steroid hormones.

Is AKR1B10 protein associated with hepatotoxicity?

AKR1B10 protein is involved in the metabolism of some drugs and may be related to hepatotoxicity, which is a hot molecule in the study of drug metabolism and toxicity.

What diseases is AKR1B10 associated with?

AKR1B10 protein is associated with a variety of diseases, such as tumors, lung diseases, metabolic diseases, and neurological diseases.

In what retinal diseases is AKR1B10 associated?

AKR1B10 protein is involved in the metabolism of retinal glycoglycation end products, which is associated with diabetic retinopathy and other diseases.