Recombinant Human AKR1B10
Cat.No. : | AKR1B10-27154TH |
Product Overview : | Recombinant full length Human AKR1B10 protein , 36 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 316 amino acids |
Description : | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis. |
Molecular Weight : | 36.000kDa |
Tissue specificity : | Found in many tissues. Highly expressed in small intestine, colon and adrenal gland. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol |
Storage : | Please see Notes section |
Sequences of amino acids : | MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGY RHIDCAYVYQNEHEVGEAIQEKIQEKAVKREDLFIVSKLW PTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGD DLFPKDDKGNAIGGKATFLDAWEAMEELVDEGLVKALGVS NFSHFQIEKLLNKPGLKYKPVTNQVECHPYLTQEKLIQYC HSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAK HKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFK LSDEEMATILSFNRNWRACNVLQSSHLEDYPFDAEY |
Sequence Similarities : | Belongs to the aldo/keto reductase family. |
Gene Name | AKR1B10 aldo-keto reductase family 1, member B10 (aldose reductase) [ Homo sapiens ] |
Official Symbol | AKR1B10 |
Synonyms | AKR1B10; aldo-keto reductase family 1, member B10 (aldose reductase); AKR1B11; aldo-keto reductase family 1 member B10; AKR1B12; aldo keto reductase family 1; member B11 (aldose reductase like); aldose reductase like 1; aldose reductase like peptide; aldo |
Gene ID | 57016 |
mRNA Refseq | NM_020299 |
Protein Refseq | NP_064695 |
MIM | 604707 |
Uniprot ID | O60218 |
Chromosome Location | 7q33 |
Pathway | Butanoate metabolism, organism-specific biosystem; Butanoate metabolism, conserved biosystem; Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Linoleic acid metabolism, organism-specific biosystem; |
Function | aldo-keto reductase (NADP) activity; oxidoreductase activity; protein binding; |
◆ Recombinant Proteins | ||
AKR1B10-1365HF | Recombinant Full Length Human AKR1B10 Protein, GST-tagged | +Inquiry |
AKR1B10-301110H | Recombinant Human AKR1B10 protein, GST-tagged | +Inquiry |
AKR1B10-0255H | Recombinant Human AKR1B10 Protein (M1-Y316), His tagged | +Inquiry |
AKR1B10-0093H | Recombinant Human AKR1B10 Protein (Met1-Tyr316), N-His-tagged | +Inquiry |
AKR1B10-995H | Active Recombinant Human AKR1B10 Protein, Met & His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKR1B10-8931HCL | Recombinant Human AKR1B10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AKR1B10 Products
Required fields are marked with *
My Review for All AKR1B10 Products
Required fields are marked with *
0
Inquiry Basket