Recombinant Human ALAS1 Protein, GST-tagged

Cat.No. : ALAS1-429H
Product Overview : Human ALAS1 partial ORF ( NP_000679, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes the mitochondrial enzyme which is catalyzes the rate-limiting step in heme (iron-protoporphyrin) biosynthesis. The enzyme encoded by this gene is the housekeeping enzyme; a separate gene encodes a form of the enzyme that is specific for erythroid tissue. The level of the mature encoded protein is regulated by heme: high levels of heme down-regulate the mature enzyme in mitochondria while low heme levels up-regulate. A pseudogene of this gene is located on chromosome 12. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2015]
Molecular Mass : 36.52 kDa
AA Sequence : MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ALAS1 aminolevulinate, delta-, synthase 1 [ Homo sapiens ]
Official Symbol ALAS1
Synonyms ALAS1; aminolevulinate, delta-, synthase 1; ALAS, ALAS3; 5-aminolevulinate synthase, nonspecific, mitochondrial; ALAS-H; delta-ALA synthase 1; migration-inducing protein 4; 5-aminolevulinic acid synthase 1; delta-aminolevulinate synthase 1; ALAS; MIG4; ALAS3; ALASH;
Gene ID 211
mRNA Refseq NM_000688
Protein Refseq NP_000679
MIM 125290
UniProt ID P13196

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALAS1 Products

Required fields are marked with *

My Review for All ALAS1 Products

Required fields are marked with *

0
cart-icon