Recombinant Human ALAS1
| Cat.No. : | ALAS1-26883TH |
| Product Overview : | Recombinant fragment of Human Alas1 with N terminal proprietary tag, 36.41kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 98 amino acids |
| Description : | Delta-aminolevulinate synthase (ALAS; EC 2.3.1.37) catalyzes the condensation of glycine with succinyl-CoA to form delta-aminolevulinic acid. This nuclear-encoded mitochondrial enzyme is the first and rate-limiting enzyme in the mammalian heme biosynthetic pathway. There are 2 tissue-specific isozymes: a housekeeping enzyme encoded by the ALAS1 gene and an erythroid tissue-specific enzyme encoded by ALAS2 (MIM 301300). |
| Molecular Weight : | 36.410kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLP |
| Sequence Similarities : | Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family. |
| Gene Name | ALAS1 aminolevulinate, delta-, synthase 1 [ Homo sapiens ] |
| Official Symbol | ALAS1 |
| Synonyms | ALAS1; aminolevulinate, delta-, synthase 1; ALAS, ALAS3; 5-aminolevulinate synthase, nonspecific, mitochondrial; |
| Gene ID | 211 |
| mRNA Refseq | NM_000688 |
| Protein Refseq | NP_000679 |
| MIM | 125290 |
| Uniprot ID | P13196 |
| Chromosome Location | 3p21 |
| Pathway | FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Glycine, serine and threonine metabolism, organism-specific biosystem; Glycine, serine and threonine metabolism, conserved biosystem; Heme Biosynthesis, organism-specific biosystem; Heme biosynthesis, organism-specific biosystem; |
| Function | 5-aminolevulinate synthase activity; pyridoxal phosphate binding; transferase activity, transferring acyl groups; transferase activity, transferring nitrogenous groups; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALAS1 Products
Required fields are marked with *
My Review for All ALAS1 Products
Required fields are marked with *




