Recombinant Human ALAS1

Cat.No. : ALAS1-26883TH
Product Overview : Recombinant fragment of Human Alas1 with N terminal proprietary tag, 36.41kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 98 amino acids
Description : Delta-aminolevulinate synthase (ALAS; EC 2.3.1.37) catalyzes the condensation of glycine with succinyl-CoA to form delta-aminolevulinic acid. This nuclear-encoded mitochondrial enzyme is the first and rate-limiting enzyme in the mammalian heme biosynthetic pathway. There are 2 tissue-specific isozymes: a housekeeping enzyme encoded by the ALAS1 gene and an erythroid tissue-specific enzyme encoded by ALAS2 (MIM 301300).
Molecular Weight : 36.410kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLP
Sequence Similarities : Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.
Gene Name ALAS1 aminolevulinate, delta-, synthase 1 [ Homo sapiens ]
Official Symbol ALAS1
Synonyms ALAS1; aminolevulinate, delta-, synthase 1; ALAS, ALAS3; 5-aminolevulinate synthase, nonspecific, mitochondrial;
Gene ID 211
mRNA Refseq NM_000688
Protein Refseq NP_000679
MIM 125290
Uniprot ID P13196
Chromosome Location 3p21
Pathway FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Glycine, serine and threonine metabolism, organism-specific biosystem; Glycine, serine and threonine metabolism, conserved biosystem; Heme Biosynthesis, organism-specific biosystem; Heme biosynthesis, organism-specific biosystem;
Function 5-aminolevulinate synthase activity; pyridoxal phosphate binding; transferase activity, transferring acyl groups; transferase activity, transferring nitrogenous groups;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALAS1 Products

Required fields are marked with *

My Review for All ALAS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon