Recombinant Human ALAS1
Cat.No. : | ALAS1-26883TH |
Product Overview : | Recombinant fragment of Human Alas1 with N terminal proprietary tag, 36.41kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 98 amino acids |
Description : | Delta-aminolevulinate synthase (ALAS; EC 2.3.1.37) catalyzes the condensation of glycine with succinyl-CoA to form delta-aminolevulinic acid. This nuclear-encoded mitochondrial enzyme is the first and rate-limiting enzyme in the mammalian heme biosynthetic pathway. There are 2 tissue-specific isozymes: a housekeeping enzyme encoded by the ALAS1 gene and an erythroid tissue-specific enzyme encoded by ALAS2 (MIM 301300). |
Molecular Weight : | 36.410kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLP |
Sequence Similarities : | Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family. |
Gene Name | ALAS1 aminolevulinate, delta-, synthase 1 [ Homo sapiens ] |
Official Symbol | ALAS1 |
Synonyms | ALAS1; aminolevulinate, delta-, synthase 1; ALAS, ALAS3; 5-aminolevulinate synthase, nonspecific, mitochondrial; |
Gene ID | 211 |
mRNA Refseq | NM_000688 |
Protein Refseq | NP_000679 |
MIM | 125290 |
Uniprot ID | P13196 |
Chromosome Location | 3p21 |
Pathway | FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Glycine, serine and threonine metabolism, organism-specific biosystem; Glycine, serine and threonine metabolism, conserved biosystem; Heme Biosynthesis, organism-specific biosystem; Heme biosynthesis, organism-specific biosystem; |
Function | 5-aminolevulinate synthase activity; pyridoxal phosphate binding; transferase activity, transferring acyl groups; transferase activity, transferring nitrogenous groups; |
◆ Recombinant Proteins | ||
ALAS1-26883TH | Recombinant Human ALAS1 | +Inquiry |
Alas1-111R | Recombinant Rat Alas1 Protein, His&GST-tagged | +Inquiry |
ALAS1-311H | Recombinant Human ALAS1 Protein, His-tagged | +Inquiry |
ALAS1-11435Z | Recombinant Zebrafish ALAS1 | +Inquiry |
Alas1-4696M | Recombinant Mouse Alas1 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALAS1-8925HCL | Recombinant Human ALAS1 293 Cell Lysate | +Inquiry |
ALAS1-8924HCL | Recombinant Human ALAS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALAS1 Products
Required fields are marked with *
My Review for All ALAS1 Products
Required fields are marked with *
0
Inquiry Basket