Creative BioMart to Present at BPS 2025 Annual Meeting | February 15-19, 2025

Recombinant Human CA6

Cat.No. : CA6-26132TH
Product Overview : Recombinant full length Human CA6 with a N terminal proprietary tag; Predicted MWt 59.95 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene is one of several isozymes of carbonic anhydrase. This protein is found only in salivary glands and saliva and protein may play a role in the reversible hydratation of carbon dioxide though its function in saliva is unknown.
Protein length : 308 amino acids
Molecular Weight : 59.950kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Major constituent of saliva.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQH YPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEF PMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGAS SEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDG LAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTG LDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVK LSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNF PNQEYTLGSEFQFYLHKIEEILDYLRRALN
Sequence Similarities : Belongs to the alpha-carbonic anhydrase family.
Tag : Non
Gene Name : CA6 carbonic anhydrase VI [ Homo sapiens ]
Official Symbol : CA6
Synonyms : CA6; carbonic anhydrase VI; carbonic anhydrase 6;
Gene ID : 765
mRNA Refseq : NM_001215
Protein Refseq : NP_001206
MIM : 114780
Uniprot ID : P23280
Chromosome Location : 1p36.2
Pathway : Nitrogen metabolism, organism-specific biosystem; Nitrogen metabolism, conserved biosystem;
Function : carbonate dehydratase activity; lyase activity; metal ion binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (3)

Write a review
Reviews
12/15/2021

    Outstanding purification techniques, yield top-notch samples.

    09/26/2021

      Fast turnaround time, meets our project deadlines efficiently.

      07/01/2021

        Efficient sample handling, simplifies our daily workloads.

        Q&As (7)

        Ask a question
        Are there known genetic mutations in the CA6 gene, and how do they influence protein function? 04/05/2021

        Genetic variations might affect CA6's secretion or activity, necessitating functional assays for evaluation.

        What is the primary physiological function of CA6? 02/04/2021

        CA6 plays a role in the reversible conversion of CO2 to bicarbonate and protons, aiding in pH balance and CO2 transport.

        Are there any known proteins or molecules that interact directly with CA6? 05/27/2020

        Direct interaction partners for CA6 require further investigation, but it may have specific binding properties due to its unique location.

        Where is CA6 predominantly located within the human body? 04/09/2020

        CA6 is mainly secreted in saliva and is found in salivary glands.

        What are the post-translational modifications identified on CA6? 12/21/2019

        Specific post-translational modifications on CA6 can be explored through techniques like mass spectrometry.

        How does the enzymatic activity of CA6 compare to other carbonic anhydrase isoforms? 03/31/2018

        CA6's activity might be tailored for salivary pH regulation, potentially differing in kinetics from other isoforms.

        Are there specific pathological conditions linked with CA6 dysregulation? 06/24/2017

        Dysregulation of CA6 might influence oral health, pH regulation, or conditions affecting the salivary glands.

        Ask a Question for All CA6 Products

        Required fields are marked with *

        My Review for All CA6 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2025 Creative BioMart. All Rights Reserved.

        Contact Us

        • /
        • Service lnquiry:

        Stay Updated on the Latest Bioscience Trends