Recombinant Human CA6
Cat.No. : | CA6-26132TH |
Product Overview : | Recombinant full length Human CA6 with a N terminal proprietary tag; Predicted MWt 59.95 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 308 amino acids |
Description : | The protein encoded by this gene is one of several isozymes of carbonic anhydrase. This protein is found only in salivary glands and saliva and protein may play a role in the reversible hydratation of carbon dioxide though its function in saliva is unknown. |
Molecular Weight : | 59.950kDa inclusive of tags |
Tissue specificity : | Major constituent of saliva. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQH YPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEF PMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGAS SEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDG LAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTG LDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVK LSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNF PNQEYTLGSEFQFYLHKIEEILDYLRRALN |
Sequence Similarities : | Belongs to the alpha-carbonic anhydrase family. |
Gene Name | CA6 carbonic anhydrase VI [ Homo sapiens ] |
Official Symbol | CA6 |
Synonyms | CA6; carbonic anhydrase VI; carbonic anhydrase 6; |
Gene ID | 765 |
mRNA Refseq | NM_001215 |
Protein Refseq | NP_001206 |
MIM | 114780 |
Uniprot ID | P23280 |
Chromosome Location | 1p36.2 |
Pathway | Nitrogen metabolism, organism-specific biosystem; Nitrogen metabolism, conserved biosystem; |
Function | carbonate dehydratase activity; lyase activity; metal ion binding; zinc ion binding; |
◆ Recombinant Proteins | ||
CA6-350H | Recombinant Human CA6 Protein, His&GST-tagged | +Inquiry |
CA6-527H | Active Recombinant Human CA6, His-tagged | +Inquiry |
Car6-7841R | Recombinant Rat Car6 protein, His & T7-tagged | +Inquiry |
CA6-2742HF | Recombinant Full Length Human CA6 Protein, GST-tagged | +Inquiry |
CA6-26443TH | Recombinant Human CA6 | +Inquiry |
◆ Native Proteins | ||
CA6-804H | Native Human CA6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA6-266HCL | Recombinant Human CA6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CA6 Products
Required fields are marked with *
My Review for All CA6 Products
Required fields are marked with *
0
Inquiry Basket