Recombinant Human CA6

• Cat.No.: CA6-26132TH
• Product Overview: Recombinant full length Human CA6 with a N terminal proprietary tag; Predicted MWt 59.95 kDa.

Specification

• Description: The protein encoded by this gene is one of several isozymes of carbonic anhydrase. This protein is found only in salivary glands and saliva and protein may play a role in the reversible hydratation of carbon dioxide though its function in saliva is unknown.
• Protein length: 308 amino acids
• Molecular Weight: 59.950kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Major constituent of saliva.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQH YPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEF PMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGAS SEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDG LAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTG LDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVK LSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNF PNQEYTLGSEFQFYLHKIEEILDYLRRALN
• Sequence Similarities: Belongs to the alpha-carbonic anhydrase family.
• Tag: Non

Gene Information

• Gene Name: CA6 carbonic anhydrase VI [ Homo sapiens ]
• Official Symbol: CA6
• Synonyms: CA6; carbonic anhydrase VI; carbonic anhydrase 6
• Gene ID: 765
• mRNA Refseq: NM_001215
• Protein Refseq: NP_001206
• MIM: 114780
• Uniprot ID: P23280
• Chromosome Location: 1p36.2
• Pathway: Nitrogen metabolism, organism-specific biosystem; Nitrogen metabolism, conserved biosystem
• Function: carbonate dehydratase activity; lyase activity; metal ion binding; zinc ion binding

Reviews

12/15/2021

Outstanding purification techniques, yield top-notch samples.

09/26/2021

Fast turnaround time, meets our project deadlines efficiently.

07/01/2021

Efficient sample handling, simplifies our daily workloads.

Q&As

Are there known genetic mutations in the CA6 gene, and how do they influence protein function?

Genetic variations might affect CA6's secretion or activity, necessitating functional assays for evaluation.

What is the primary physiological function of CA6?

CA6 plays a role in the reversible conversion of CO2 to bicarbonate and protons, aiding in pH balance and CO2 transport.

Are there any known proteins or molecules that interact directly with CA6?

Direct interaction partners for CA6 require further investigation, but it may have specific binding properties due to its unique location.

Where is CA6 predominantly located within the human body?

CA6 is mainly secreted in saliva and is found in salivary glands.

What are the post-translational modifications identified on CA6?

Specific post-translational modifications on CA6 can be explored through techniques like mass spectrometry.

How does the enzymatic activity of CA6 compare to other carbonic anhydrase isoforms?

CA6's activity might be tailored for salivary pH regulation, potentially differing in kinetics from other isoforms.

Are there specific pathological conditions linked with CA6 dysregulation?

Dysregulation of CA6 might influence oral health, pH regulation, or conditions affecting the salivary glands.