Recombinant Human CA6
Cat.No. : | CA6-26132TH |
Product Overview : | Recombinant full length Human CA6 with a N terminal proprietary tag; Predicted MWt 59.95 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene is one of several isozymes of carbonic anhydrase. This protein is found only in salivary glands and saliva and protein may play a role in the reversible hydratation of carbon dioxide though its function in saliva is unknown. |
Protein length : | 308 amino acids |
Molecular Weight : | 59.950kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Major constituent of saliva. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQH YPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEF PMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGAS SEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDG LAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTG LDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVK LSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNF PNQEYTLGSEFQFYLHKIEEILDYLRRALN |
Sequence Similarities : | Belongs to the alpha-carbonic anhydrase family. |
Tag : | Non |
Gene Name : | CA6 carbonic anhydrase VI [ Homo sapiens ] |
Official Symbol : | CA6 |
Synonyms : | CA6; carbonic anhydrase VI; carbonic anhydrase 6; |
Gene ID : | 765 |
mRNA Refseq : | NM_001215 |
Protein Refseq : | NP_001206 |
MIM : | 114780 |
Uniprot ID : | P23280 |
Chromosome Location : | 1p36.2 |
Pathway : | Nitrogen metabolism, organism-specific biosystem; Nitrogen metabolism, conserved biosystem; |
Function : | carbonate dehydratase activity; lyase activity; metal ion binding; zinc ion binding; |
Products Types
◆ Recombinant Protein | ||
CA6-0245H | Recombinant Human CA6 Protein, GST-Tagged | +Inquiry |
CA6-2577H | Recombinant Human CA6 Protein, His (Fc)-Avi-tagged | +Inquiry |
Car6-826M | Recombinant Mouse Car6 Protein, MYC/DDK-tagged | +Inquiry |
CA6-350H | Recombinant Human CA6 Protein, His&GST-tagged | +Inquiry |
CA6-1161M | Recombinant Mouse CA6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Protein | ||
CA6-804H | Native Human CA6 | +Inquiry |
◆ Lysates | ||
CA6-266HCL | Recombinant Human CA6 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Reviews
- Q&As
Customer Reviews (3)
Write a reviewOutstanding purification techniques, yield top-notch samples.
Fast turnaround time, meets our project deadlines efficiently.
Efficient sample handling, simplifies our daily workloads.
Q&As (7)
Ask a questionGenetic variations might affect CA6's secretion or activity, necessitating functional assays for evaluation.
CA6 plays a role in the reversible conversion of CO2 to bicarbonate and protons, aiding in pH balance and CO2 transport.
Direct interaction partners for CA6 require further investigation, but it may have specific binding properties due to its unique location.
CA6 is mainly secreted in saliva and is found in salivary glands.
Specific post-translational modifications on CA6 can be explored through techniques like mass spectrometry.
CA6's activity might be tailored for salivary pH regulation, potentially differing in kinetics from other isoforms.
Dysregulation of CA6 might influence oral health, pH regulation, or conditions affecting the salivary glands.
Ask a Question for All CA6 Products
Required fields are marked with *
My Review for All CA6 Products
Required fields are marked with *
Inquiry Basket