"CA6" Related Products

Expand
Expand

Native Human CA6

Cat.No.: CA6-804H
Product Overview: Native Human CA6 was isolated from human milk.
Description: Carbonic anhydrases (CAs) are enzymes which catalyze the reversible hydration of carbon dioxide according to the following reaction: CO2 + H2O ↔ HCO3- + H+. The main function of this protein family is to regulate the acid-base balance, which is of a considerable biological importance. In addition, they participate in several other physiological functions including CO2 and HCO3- transport, bone resorption, production of biological fluids, ureagenesis, gluconeogenesis and lipogenesis. Carbonic anhydrases are metalloenzymes containing a zinc-atom in their active site. The expanding CA gene family includes at least 13 enzymatically active members with different structural and catalytic properties.
Purified by CA inhibitor affinity chromatography.
Source: Human milk
Species: Human
Form: 0.1 M Tris-SO4 pH 7.0, 0.4 M NaN3, 1 mM Benzamidine and 20 % glycerol, pH 7.0
Molecular Mass: 35 kDa
AASequence: MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN
Purity: > 95 % (SDS-PAGE under reducing conditions)
Storage: Store at -80 centigrade, avoid freeze/thaw cycles.
Gene Name: CA6 carbonic anhydrase VI [ Homo sapiens ]
Official Symbol: CA6
Synonyms: CA-VI; GUSTIN
Gene ID: 765
mRNA Refseq: NM_001215.3
Protein Refseq: NP_001206.2
MIM: 114780
UniProt ID: P23280

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.