| Species : |
Human |
| Source : |
Human milk |
| Tag : |
Non |
| Description : |
Carbonic anhydrases (CAs) are enzymes which catalyze the reversible hydration of carbon dioxide according to the following reaction: CO2 + H2O ↔ HCO3- + H+. The main function of this protein family is to regulate the acid-base balance, which is of a considerable biological importance. In addition, they participate in several other physiological functions including CO2 and HCO3- transport, bone resorption, production of biological fluids, ureagenesis, gluconeogenesis and lipogenesis. Carbonic anhydrases are metalloenzymes containing a zinc-atom in their active site. The expanding CA gene family includes at least 13 enzymatically active members with different structural and catalytic properties. Purified by CA inhibitor affinity chromatography. |
| Form : |
0.1 M Tris-SO4 pH 7.0, 0.4 M NaN3, 1 mM Benzamidine and 20 % glycerol, pH 7.0 |
| Molecular Mass : |
35 kDa |
| Purity : |
> 95 % (SDS-PAGE under reducing conditions) |
| Storage : |
Store at -80 centigrade, avoid freeze/thaw cycles. |
| AA Sequence : |
MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN |