Native Human CA6

Species :	Human
Source :	Human milk
Tag :	Non
Description :	Carbonic anhydrases (CAs) are enzymes which catalyze the reversible hydration of carbon dioxide according to the following reaction: CO2 + H2O ↔ HCO3- + H+. The main function of this protein family is to regulate the acid-base balance, which is of a considerable biological importance. In addition, they participate in several other physiological functions including CO2 and HCO3- transport, bone resorption, production of biological fluids, ureagenesis, gluconeogenesis and lipogenesis. Carbonic anhydrases are metalloenzymes containing a zinc-atom in their active site. The expanding CA gene family includes at least 13 enzymatically active members with different structural and catalytic properties. Purified by CA inhibitor affinity chromatography.
Form :	0.1 M Tris-SO4 pH 7.0, 0.4 M NaN3, 1 mM Benzamidine and 20 % glycerol, pH 7.0
Molecular Mass :	35 kDa
Purity :	> 95 % (SDS-PAGE under reducing conditions)
Storage :	Store at -80 centigrade, avoid freeze/thaw cycles.
AA Sequence :	MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN

Gene Name	CA6 carbonic anhydrase VI [ Homo sapiens ]
Official Symbol	CA6
Synonyms	CA-VI; GUSTIN
Gene ID	765
mRNA Refseq	NM_001215.3
Protein Refseq	NP_001206.2
MIM	114780
UniProt ID	P23280