Native Human CA6
Cat.No. : | CA6-804H |
Product Overview : | Native Human CA6 was isolated from human milk. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human milk |
Tag : | Non |
Description : | Carbonic anhydrases (CAs) are enzymes which catalyze the reversible hydration of carbon dioxide according to the following reaction: CO2 + H2O ↔ HCO3- + H+. The main function of this protein family is to regulate the acid-base balance, which is of a considerable biological importance. In addition, they participate in several other physiological functions including CO2 and HCO3- transport, bone resorption, production of biological fluids, ureagenesis, gluconeogenesis and lipogenesis. Carbonic anhydrases are metalloenzymes containing a zinc-atom in their active site. The expanding CA gene family includes at least 13 enzymatically active members with different structural and catalytic properties. Purified by CA inhibitor affinity chromatography. |
Form : | 0.1 M Tris-SO4 pH 7.0, 0.4 M NaN3, 1 mM Benzamidine and 20 % glycerol, pH 7.0 |
Molecular Mass : | 35 kDa |
Purity : | > 95 % (SDS-PAGE under reducing conditions) |
Storage : | Store at -80 centigrade, avoid freeze/thaw cycles. |
AA Sequence : | MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN |
Gene Name | CA6 carbonic anhydrase VI [ Homo sapiens ] |
Official Symbol | CA6 |
Synonyms | CA-VI; GUSTIN |
Gene ID | 765 |
mRNA Refseq | NM_001215.3 |
Protein Refseq | NP_001206.2 |
MIM | 114780 |
UniProt ID | P23280 |
◆ Recombinant Proteins | ||
Car6-826M | Recombinant Mouse Car6 Protein, MYC/DDK-tagged | +Inquiry |
CA6-2268H | Recombinant Human CA6 Protein, MYC/DDK-tagged | +Inquiry |
Car6-7839M | Recombinant Mouse Car6 protein, His-tagged | +Inquiry |
CA6-613H | Recombinant Human CA6 protein, His&Myc-tagged | +Inquiry |
Car6-7840M | Recombinant Mouse Car6 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CA6-804H | Native Human CA6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA6-266HCL | Recombinant Human CA6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CA6 Products
Required fields are marked with *
My Review for All CA6 Products
Required fields are marked with *
0
Inquiry Basket