Native Human CA6

Cat.No. : CA6-804H
Product Overview : Native Human CA6 was isolated from human milk.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human milk
Tag : Non
Description : Carbonic anhydrases (CAs) are enzymes which catalyze the reversible hydration of carbon dioxide according to the following reaction: CO2 + H2O ↔ HCO3- + H+. The main function of this protein family is to regulate the acid-base balance, which is of a considerable biological importance. In addition, they participate in several other physiological functions including CO2 and HCO3- transport, bone resorption, production of biological fluids, ureagenesis, gluconeogenesis and lipogenesis. Carbonic anhydrases are metalloenzymes containing a zinc-atom in their active site. The expanding CA gene family includes at least 13 enzymatically active members with different structural and catalytic properties.
Purified by CA inhibitor affinity chromatography.
Form : 0.1 M Tris-SO4 pH 7.0, 0.4 M NaN3, 1 mM Benzamidine and 20 % glycerol, pH 7.0
Molecular Mass : 35 kDa
Purity : > 95 % (SDS-PAGE under reducing conditions)
Storage : Store at -80 centigrade, avoid freeze/thaw cycles.
AA Sequence : MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN
Gene Name CA6 carbonic anhydrase VI [ Homo sapiens ]
Official Symbol CA6
Synonyms CA-VI; GUSTIN
Gene ID 765
mRNA Refseq NM_001215.3
Protein Refseq NP_001206.2
MIM 114780
UniProt ID P23280

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CA6 Products

Required fields are marked with *

My Review for All CA6 Products

Required fields are marked with *

0
cart-icon
0
compare icon