"CA6" Related Products

Expand
Expand

Native Human CA6

Cat.No.: CA6-804H
Product Overview: Native Human CA6 was isolated from human milk.
Description: Carbonic anhydrases (CAs) are enzymes which catalyze the reversible hydration of carbon dioxide according to the following reaction: CO2 + H2O ↔ HCO3- + H+. The main function of this protein family is to regulate the acid-base balance, which is of a considerable biological importance. In addition, they participate in several other physiological functions including CO2 and HCO3- transport, bone resorption, production of biological fluids, ureagenesis, gluconeogenesis and lipogenesis. Carbonic anhydrases are metalloenzymes containing a zinc-atom in their active site. The expanding CA gene family includes at least 13 enzymatically active members with different structural and catalytic properties.
Purified by CA inhibitor affinity chromatography.
Source: Human milk
Species: Human
Form: 0.1 M Tris-SO4 pH 7.0, 0.4 M NaN3, 1 mM Benzamidine and 20 % glycerol, pH 7.0
Molecular Mass: 35 kDa
AASequence: MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN
Purity: > 95 % (SDS-PAGE under reducing conditions)
Storage: Store at -80 centigrade, avoid freeze/thaw cycles.
Gene Name: CA6 carbonic anhydrase VI [ Homo sapiens ]
Official Symbol: CA6
Synonyms: CA-VI; GUSTIN
Gene ID: 765
mRNA Refseq: NM_001215.3
Protein Refseq: NP_001206.2
MIM: 114780
UniProt ID: P23280

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.