Recombinant Human CA6 protein, His&Myc-tagged
| Cat.No. : | CA6-613H |
| Product Overview : | Recombinant Human CA6 protein(P23280)(18-308aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 18-308a.a. |
| Tag : | His&Myc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 41.0 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | QHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN |
| Gene Name | CA6 carbonic anhydrase VI [ Homo sapiens ] |
| Official Symbol | CA6 |
| Synonyms | CA6; carbonic anhydrase VI; carbonic anhydrase 6; carbonate dehydratase VI; salivary carbonic anhydrase; secreted carbonic anhydrase; CA-VI; GUSTIN; MGC21256; |
| Gene ID | 765 |
| mRNA Refseq | NM_001215 |
| Protein Refseq | NP_001206 |
| MIM | 114780 |
| UniProt ID | P23280 |
| ◆ Recombinant Proteins | ||
| CA6-26132TH | Recombinant Human CA6 | +Inquiry |
| CA6-527H | Active Recombinant Human CA6, His-tagged | +Inquiry |
| Car6-7840M | Recombinant Mouse Car6 protein, His-tagged | +Inquiry |
| CA6-0245H | Recombinant Human CA6 Protein, GST-Tagged | +Inquiry |
| CA6-613H | Recombinant Human CA6 protein, His&Myc-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CA6-804H | Native Human CA6 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CA6-266HCL | Recombinant Human CA6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CA6 Products
Required fields are marked with *
My Review for All CA6 Products
Required fields are marked with *
