Recombinant Human CCL1 Protein
Cat.No. : | CCL1-69H |
Product Overview : | Recombinant Human CCL1 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 73 amino acid |
Description : | Recombinant human CCL1 is expressed in E. coli, refolded and purified to yield the 73 residue mature protein that is secreted from cells after cleavage of the signal peptide. Human CCL1, also designated T lymphocyte-secreted protein I-309 and TCA-3, chemoattracts monocytes and Th2 differentiated T-cells through activation of the G protein-coupled receptor CCR8. CCL1 plays an active role in bronchial asthma and atopic dermatitis. |
Form : | Lyophilized |
Molecular Mass : | 8.4861 kDa |
AA Sequence : | KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALD TVGWVQRHRKMLRHCPSKRK |
Endotoxin : | Endotoxin-free <0.01 EU/ug |
Purity : | Purity assessed by HPLC, Mass Spectrometry, and NMR |
Storage : | Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month. |
tmpcolum67 : | C-C motif chemokine ligand 1 |
Gene Name | CCL1 C-C motif chemokine ligand 1 [ Homo sapiens (human) ] |
Official Symbol | CCL1 |
Synonyms | P500; SISe; TCA3; I-309; SCYA1 |
Gene ID | 6346 |
mRNA Refseq | NM_002981 |
Protein Refseq | NP_002972 |
MIM | 182281 |
UniProt ID | P22362 |
◆ Recombinant Proteins | ||
CCL1-168H | Recombinant Human CCL1, His-tagged | +Inquiry |
Ccl1-621M | Recombinant Mouse Ccl1 protein(Lys24-Cys92), hFc-tagged | +Inquiry |
Ccl1-2027M | Active Recombinant Mouse Ccl1 Protein | +Inquiry |
Ccl1-10525M | Recombinant Mouse Ccl1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL1-266C | Active Recombinant Human CCL1 Protein (73 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL1-3060HCL | Recombinant Human CCL1 cell lysate | +Inquiry |
CCL1-1690MCL | Recombinant Mouse CCL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL1 Products
Required fields are marked with *
My Review for All CCL1 Products
Required fields are marked with *
0
Inquiry Basket