Recombinant Human CCL1 Protein

Cat.No. : CCL1-69H
Product Overview : Recombinant Human CCL1 Protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 73 amino acid
Description : Recombinant human CCL1 is expressed in E. coli, refolded and purified to yield the 73 residue mature protein that is secreted from cells after cleavage of the signal peptide. Human CCL1, also designated T lymphocyte-secreted protein I-309 and TCA-3, chemoattracts monocytes and Th2 differentiated T-cells through activation of the G protein-coupled receptor CCR8. CCL1 plays an active role in bronchial asthma and atopic dermatitis.
Form : Lyophilized
Molecular Mass : 8.4861 kDa
AA Sequence : KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALD TVGWVQRHRKMLRHCPSKRK
Endotoxin : Endotoxin-free <0.01 EU/ug
Purity : Purity assessed by HPLC, Mass Spectrometry, and NMR
Storage : Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month.
tmpcolum67 : C-C motif chemokine ligand 1
Gene Name CCL1 C-C motif chemokine ligand 1 [ Homo sapiens (human) ]
Official Symbol CCL1
Synonyms P500; SISe; TCA3; I-309; SCYA1
Gene ID 6346
mRNA Refseq NM_002981
Protein Refseq NP_002972
MIM 182281
UniProt ID P22362

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL1 Products

Required fields are marked with *

My Review for All CCL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon