Active Recombinant Human CCL5 Protein
Cat.No. : | CCL5-27H |
Product Overview : | Recombinant Human CCL5 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Regulated upon activation, normal T cell expressed and secreted (RANTES), also called CCL5, is a chemokine produced by T cells three to five days after T cell activation. RANTES signals through G protein-coupled receptors CCR5, CCR3, CCR1, and through the human CMV-encoded viral receptor US28. RANTES functions to recruit immune cells to inflammatory sites. |
Bio-activity : | THP-1 chemotaxis, ≤250 ng/mL |
Molecular Mass : | Monomer, 7.9 kDa (68 aa) |
AA Sequence : | SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | CCL5 chemokine (C-C motif) ligand 5 [ Homo sapiens (human) ] |
Official Symbol | CCL5 |
Synonyms | CCL5; chemokine (C-C motif) ligand 5; D17S136E, SCYA5, small inducible cytokine A5 (RANTES); C-C motif chemokine 5; beta chemokine RANTES; MGC17164; RANTES; regulated upon activation; normally T expressed; and presumably secreted; SIS delta; SISd; small inducible cytokine subfamily A (Cys Cys); member 5; T cell specific protein p288; T cell specific RANTES protein; TCP228; eoCP; SIS-delta; beta-chemokine RANTES; small-inducible cytokine A5; T-cell specific protein p288; t cell-specific protein P228; T-cell-specific protein RANTES; eosinophil chemotactic cytokine; small inducible cytokine A5 (RANTES); small inducible cytokine subfamily A (Cys-Cys), member 5; regulated upon activation, normally T-expressed, and presumably secreted; SCYA5; D17S136E; |
Gene ID | 6352 |
mRNA Refseq | NM_002985 |
Protein Refseq | NP_002976 |
MIM | 187011 |
UniProt ID | P13501 |
◆ Recombinant Proteins | ||
CCL5-521R | Recombinant Rhesus Macaque CCL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL5-427F | Recombinant Feline CCL5 Protein | +Inquiry |
Ccl5-133M | Active Recombinant Mouse Ccl5 Protein | +Inquiry |
CCL5-57H | Recombinant Human CCL5 Protein, Biotin-tagged | +Inquiry |
CCL5-511H | Active Recombinant Mouse Chemokine (C-C motif) Ligand 5, HIgG1 Fc-tagged, mutant | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL5-2706HCL | Recombinant Human CCL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL5 Products
Required fields are marked with *
My Review for All CCL5 Products
Required fields are marked with *
0
Inquiry Basket