Recombinant Human CD59 Protein, C-His-tagged
Cat.No. : | CD59-202H |
Product Overview : | Recombinant Human CD59 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | CD59 is a GPI-anchored membrane protein that functions as inhibitor of the complement membrane attack complex (MAC). CD59 binds to complement components C8 and C9, preventing C9 polymerization and insertion into membranes, therefore inhibiting the complement-dependent cytolysis (CDC). CD59 is a ubiquitously expressed cell membrane protein that protects cells from CDC. Rare cases of CD59 deficiency have been reported to cause paroxysmal nocturnal hemoglobinuria in human patients. Expression of CD59 on tumor cells and viral infected cells makes them resist antibody-dependent complement-mediated lysis. Potent inhibitors for CD59 have been actively pursued for therapeutic applications. In addition, CD59 may regulate insulin secretion by modulating exocytosis. |
Molecular Mass : | ~9 kDa |
AA Sequence : | LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD59 CD59 molecule, complement regulatory protein [ Homo sapiens (human) ] |
Official Symbol | CD59 |
Synonyms | CD59; CD59 molecule, complement regulatory protein; CD59 antigen p18 20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344) , CD59 antigen, complement regulatory protein , MIC11, MIN1, MIN2, MIN3, MSK21; CD59 glycoprotein; 16.3A5; EJ16; EJ30; EL32; G344; p18 20; protectin; 1F5 antigen; MEM43 antigen; Ly-6-like protein; T cell-activating protein; human leukocyte antigen MIC11; lymphocytic antigen CD59/MEM43; 20 kDa homologous restriction factor; membrane inhibitor of reactive lysis; membrane attack complex inhibition factor; membrane attack complex (MAC) inhibition factor; surface anitgen recognized by monoclonal 16.3A5; CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344); 1F5; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; HRF-20; MAC-IP; p18-20; MGC2354; FLJ38134; FLJ92039; |
Gene ID | 966 |
mRNA Refseq | NM_000611 |
Protein Refseq | NP_000602 |
MIM | 107271 |
UniProt ID | P13987 |
◆ Recombinant Proteins | ||
CD59-15902H | Recombinant Human CD59, His-tagged | +Inquiry |
CD59-918R | Recombinant Rat CD59 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD59-6833R | Recombinant Rhesus monkey CD59 protein, His & S-tagged | +Inquiry |
CD59-0836H | Recombinant Human CD59 Protein, GST-Tagged | +Inquiry |
CD59-392C | Recombinant Cynomolgus CD59 protein(Met1-Glu101), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD59-1968HCL | Recombinant Human CD59 cell lysate | +Inquiry |
CD59-1019CCL | Recombinant Cynomolgus CD59 cell lysate | +Inquiry |
CD59-1365RCL | Recombinant Rat CD59 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD59 Products
Required fields are marked with *
My Review for All CD59 Products
Required fields are marked with *
0
Inquiry Basket