Recombinant Human CD59 Protein, C-His-tagged

Cat.No. : CD59-202H
Product Overview : Recombinant Human CD59 Protein with C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : CD59 is a GPI-anchored membrane protein that functions as inhibitor of the complement membrane attack complex (MAC). CD59 binds to complement components C8 and C9, preventing C9 polymerization and insertion into membranes, therefore inhibiting the complement-dependent cytolysis (CDC). CD59 is a ubiquitously expressed cell membrane protein that protects cells from CDC. Rare cases of CD59 deficiency have been reported to cause paroxysmal nocturnal hemoglobinuria in human patients. Expression of CD59 on tumor cells and viral infected cells makes them resist antibody-dependent complement-mediated lysis. Potent inhibitors for CD59 have been actively pursued for therapeutic applications. In addition, CD59 may regulate insulin secretion by modulating exocytosis.
Molecular Mass : ~9 kDa
AA Sequence : LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name CD59 CD59 molecule, complement regulatory protein [ Homo sapiens (human) ]
Official Symbol CD59
Synonyms CD59; CD59 molecule, complement regulatory protein; CD59 antigen p18 20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344) , CD59 antigen, complement regulatory protein , MIC11, MIN1, MIN2, MIN3, MSK21; CD59 glycoprotein; 16.3A5; EJ16; EJ30; EL32; G344; p18 20; protectin; 1F5 antigen; MEM43 antigen; Ly-6-like protein; T cell-activating protein; human leukocyte antigen MIC11; lymphocytic antigen CD59/MEM43; 20 kDa homologous restriction factor; membrane inhibitor of reactive lysis; membrane attack complex inhibition factor; membrane attack complex (MAC) inhibition factor; surface anitgen recognized by monoclonal 16.3A5; CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344); 1F5; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; HRF-20; MAC-IP; p18-20; MGC2354; FLJ38134; FLJ92039;
Gene ID 966
mRNA Refseq NM_000611
Protein Refseq NP_000602
MIM 107271
UniProt ID P13987

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD59 Products

Required fields are marked with *

My Review for All CD59 Products

Required fields are marked with *

0
cart-icon
0
compare icon