Recombinant Human CD59 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CD59-5367H
Product Overview : CD59 MS Standard C13 and N15-labeled recombinant protein (NP_000602) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene.
Molecular Mass : 14.2 kDa
AA Sequence : MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CD59 CD59 molecule (CD59 blood group) [ Homo sapiens (human) ]
Official Symbol CD59
Synonyms CD59; CD59 molecule, complement regulatory protein; CD59 antigen p18 20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344), CD59 antigen, complement regulatory protein, MIC11, MIN1, MIN2, MIN3, MSK21; CD59 glycoprotein; 16.3A5; EJ16; EJ30; EL32; G344; p18 20; protectin; 1F5 antigen; MEM43 antigen; Ly-6-like protein; T cell-activating protein; human leukocyte antigen MIC11; lymphocytic antigen CD59/MEM43; 20 kDa homologous restriction factor; membrane inhibitor of reactive lysis; membrane attack complex inhibition factor; membrane attack complex (MAC) inhibition factor; surface anitgen recognized by monoclonal 16.3A5; CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344); 1F5; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; HRF-20; MAC-IP; p18-20; MGC2354; FLJ38134; FLJ92039;
Gene ID 966
mRNA Refseq NM_000611
Protein Refseq NP_000602
MIM 107271
UniProt ID P13987

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD59 Products

Required fields are marked with *

My Review for All CD59 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon