Recombinant Full Length Human CD59 Protein, C-Flag-tagged
Cat.No. : | CD59-1539HFL |
Product Overview : | Recombinant Full Length Human CD59 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 11.6 kDa |
AA Sequence : | MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Complement and coagulation cascades, Hematopoietic cell lineage |
Full Length : | Full L. |
Gene Name | CD59 CD59 molecule (CD59 blood group) [ Homo sapiens (human) ] |
Official Symbol | CD59 |
Synonyms | 1F5; EJ16; EJ30; EL32; G344; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; 16.3A5; HRF-20; MAC-IP; p18-20 |
Gene ID | 966 |
mRNA Refseq | NM_000611.6 |
Protein Refseq | NP_000602.1 |
MIM | 107271 |
UniProt ID | P13987 |
◆ Recombinant Proteins | ||
CD59-1539HFL | Recombinant Full Length Human CD59 Protein, C-Flag-tagged | +Inquiry |
CD59-97C | Recombinant Cynomolgus CD59, His tagged | +Inquiry |
CD59-0836H | Recombinant Human CD59 Protein, GST-Tagged | +Inquiry |
CD59-2667H | Recombinant Human CD59 protein, GST-tagged | +Inquiry |
CD59-572R | Recombinant Rhesus Macaque CD59 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD59-1019CCL | Recombinant Cynomolgus CD59 cell lysate | +Inquiry |
CD59-1365RCL | Recombinant Rat CD59 cell lysate | +Inquiry |
CD59-1968HCL | Recombinant Human CD59 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD59 Products
Required fields are marked with *
My Review for All CD59 Products
Required fields are marked with *
0
Inquiry Basket