Recombinant Human CXCR3 protein, His-tagged

• Cat.No.: CXCR3-261H
• Product Overview: Recombinant Human CXCR3 protein(1-53 aa), fused with His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-53 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: CXCR3 chemokine (C-X-C motif) receptor 3 [ Homo sapiens ]
• Official Symbol: CXCR3
• Synonyms: CXCR3; chemokine (C-X-C motif) receptor 3; G protein coupled receptor 9 , GPR9; C-X-C chemokine receptor type 3; CD183; CKR L2; CMKAR3; IP10 R; MigR; CXC-R3; CXCR-3; Mig receptor; IP10 receptor; IP-10 receptor; G protein-coupled receptor 9; chemokine (C-X-C) receptor 3; interferon-inducible protein 10 receptor; GPR9; CD182; Mig-R; CKR-L2; IP10-R
• Gene ID: 2833
• mRNA Refseq: NM_001142797
• Protein Refseq: NP_001136269
• MIM: 300574
• UniProt ID: P49682