Recombinant Human CXCR3 protein, His-tagged
Cat.No. : | CXCR3-261H |
Product Overview : | Recombinant Human CXCR3 protein(1-53 aa), fused with His tag, was expressed in E.coli. |
Availability | July 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-53 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CXCR3 chemokine (C-X-C motif) receptor 3 [ Homo sapiens ] |
Official Symbol | CXCR3 |
Synonyms | CXCR3; chemokine (C-X-C motif) receptor 3; G protein coupled receptor 9 , GPR9; C-X-C chemokine receptor type 3; CD183; CKR L2; CMKAR3; IP10 R; MigR; CXC-R3; CXCR-3; Mig receptor; IP10 receptor; IP-10 receptor; G protein-coupled receptor 9; chemokine (C-X-C) receptor 3; interferon-inducible protein 10 receptor; GPR9; CD182; Mig-R; CKR-L2; IP10-R; |
Gene ID | 2833 |
mRNA Refseq | NM_001142797 |
Protein Refseq | NP_001136269 |
MIM | 300574 |
UniProt ID | P49682 |
◆ Recombinant Proteins | ||
CXCR3-26725TH | Recombinant Human CXCR3 | +Inquiry |
CXCR3-279H | Recombinant Human CXCR3 Full Length Transmembrane protein (1-368 aa), His-tagged | +Inquiry |
CXCR3-1694R | Recombinant Rat CXCR3 Protein | +Inquiry |
CXCR3-1082HFL | Active Recombinant Human CXCR3 Full Length Transmembrane protein | +Inquiry |
RFL31870CF | Recombinant Full Length Dog C-X-C Chemokine Receptor Type 3(Cxcr3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCR3-7162HCL | Recombinant Human CXCR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCR3 Products
Required fields are marked with *
My Review for All CXCR3 Products
Required fields are marked with *